Anti-TFPI antibody (ab180619)
Key features and details
- Rabbit polyclonal to TFPI
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-TFPI antibody
See all TFPI primary antibodies -
Description
Rabbit polyclonal to TFPI -
Host species
Rabbit -
Tested Applications & Species
Application Species ICC/IF HumanIHC-P MouseHumanWB Human -
Immunogen
Recombinant fragment corresponding to Human TFPI aa 29-224.
Sequence:DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQ CEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLE EDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDG PNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRG
Database link: P10646 -
Positive control
- HepG2 and HeLa cell line extracts.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 49% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab180619 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Tested applications are guaranteed to work and covered by our Abpromise guarantee.
Predicted to work for this combination of applications and species but not guaranteed.
Does not work for this combination of applications and species.
Application | Species |
---|---|
ICC/IF |
Human
|
IHC-P |
Mouse
Human
|
WB |
Human
|
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/2000. Predicted molecular weight: 35 kDa.
|
|
IHC-P |
1/50 - 1/200.
ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
|
ICC/IF |
Use at an assay dependent concentration.
|
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 35 kDa. |
IHC-P
1/50 - 1/200. ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
ICC/IF
Use at an assay dependent concentration. |
Target
-
Function
Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma. -
Tissue specificity
Mostly in endothelial cells. -
Sequence similarities
Contains 3 BPTI/Kunitz inhibitor domains. -
Domain
This inhibitor contains three inhibitory domains. The first domain interacts with VIIa and TF, the second one with Xa. -
Post-translational
modificationsO-glycosylated. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 7035 Human
- Entrez Gene: 21788 Mouse
- Omim: 152310 Human
- SwissProt: P10646 Human
- SwissProt: O54819 Mouse
- Unigene: 516578 Human
- Unigene: 124316 Mouse
- Unigene: 447013 Mouse
-
Alternative names
- Anti convertin antibody
- EPI antibody
- Extrinsic pathway inhibitor antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TFPI antibody (ab180619)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of mouse kidney tissue labelling TFPI with ab180619 at 1/100. Magnification: 200x.
-
All lanes : Anti-TFPI antibody (ab180619) at 1/500 dilution
Lane 1 : 293T cell lysate
Lane 2 : MCF-7 cell lysate
Lane 3 : Mouse lung tissue lysate
Lane 4 : Mouse heart tissue lysate
Lane 5 : Mouse spleen tissue lysate
Predicted band size: 35 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TFPI antibody (ab180619)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human liver cancer tissue labelling TFPI with ab180619 at 1/100. Magnification: 200x.
-
Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab180619. Blue DAPI for nuclear staining.
-
All lanes : Anti-TFPI antibody (ab180619) at 1/500 dilution
Lane 1 : HepG2 cell line extract
Lane 2 : HeLa cell line extract
Predicted band size: 35 kDa
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (3)
ab180619 has been referenced in 3 publications.
- Ma J et al. Role of the TGFß/PDCD4/AP-1 Signaling Pathway in Nasopharyngeal Carcinoma and Its Relationship to Prognosis. Cell Physiol Biochem 43:1392-1401 (2017). PubMed: 29017171
- Chen X et al. Comparative Profiling of Triple-Negative Breast Carcinomas Tissue Glycoproteome by Sequential Purification of Glycoproteins and Stable Isotope Labeling. Cell Physiol Biochem 38:110-21 (2016). PubMed: 26742121
- Abu El-Asrar AM et al. Coexpression of heparanase activity, cathepsin L, tissue factor, tissue factor pathway inhibitor, and MMP-9 in proliferative diabetic retinopathy. Mol Vis 22:424-35 (2016). WB, IHC . PubMed: 27168718