Overview

  • Product name
  • Description
    Rabbit polyclonal to TFPI
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human TFPI aa 29-224.
    Sequence:

    DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQ CEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLE EDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDG PNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRG


    Database link: P10646

  • Positive control
    • HepG2 and HeLa cell line extracts.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab180619 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 35 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

ICC/IF Use at an assay dependent concentration.

Target

  • Function
    Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.
  • Tissue specificity
    Mostly in endothelial cells.
  • Sequence similarities
    Contains 3 BPTI/Kunitz inhibitor domains.
  • Domain
    This inhibitor contains three inhibitory domains. The first domain interacts with VIIa and TF, the second one with Xa.
  • Post-translational
    modifications
    O-glycosylated.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Anti convertin antibody
    • EPI antibody
    • Extrinsic pathway inhibitor antibody
    • LACI antibody
    • Lipoprotein associated coagulation inhibitor antibody
    • Lipoprotein-associated coagulation inhibitor antibody
    • TFI antibody
    • TFPI 1 antibody
    • TFPI antibody
    • TFPI1 antibody
    • TFPI1_HUMAN antibody
    • Tissue factor pathway inhibitor (lipoprotein associated coagulation inhibitor) antibody
    • Tissue factor pathway inhibitor antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of mouse kidney tissue labelling TFPI with ab180619 at 1/100. Magnification: 200x.
  • All lanes : Anti-TFPI antibody (ab180619) at 1/500 dilution

    Lane 1 : 293T cell lysate
    Lane 2 : MCF-7 cell lysate
    Lane 3 : Mouse lung tissue lysate
    Lane 4 : Mouse heart tissue lysate
    Lane 5 : Mouse spleen tissue lysate

    Predicted band size: 35 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human liver cancer tissue labelling TFPI with ab180619 at 1/100. Magnification: 200x.
  • Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab180619. Blue DAPI for nuclear staining.
  • All lanes : Anti-TFPI antibody (ab180619) at 1/500 dilution

    Lane 1 : HepG2 cell line extract
    Lane 2 : HeLa cell line extract

    Predicted band size: 35 kDa

References

This product has been referenced in:
  • Abu El-Asrar AM  et al. Coexpression of heparanase activity, cathepsin L, tissue factor, tissue factor pathway inhibitor, and MMP-9 in proliferative diabetic retinopathy. Mol Vis 22:424-35 (2016). WB, IHC . Read more (PubMed: 27168718) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180619.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up