Overview

  • Product name

    Anti-TFPI antibody [C1]
    See all TFPI primary antibodies
  • Description

    Mouse monoclonal [C1] to TFPI
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Rat TFPI aa 29-302. N-terminal His tag. Expressed in E. coli. Full length mature chain without the signal peptide.
    Sequence:

    LPEEDDDTINTDSELRPMKPLHTFCAMKAEDGPCKAMIRSYYFNMNSHQC EEFIYGGCRGNKNRFDTLEECRKTCIPGYKKTTIKTTSGAEKPDFCFLEE DPGICRGFMTRYFYNNQSKQCEQFKYGGCLGNSNNFETLEECRNTCEDPV NEVQKGDYVTNQITVTDRTTVNNVVIPQATKAPSQWDYDGPSWCLEPADS GLCKASEKRFYYNPAIGKCRQFNYTGCGGNNNNFTTKQDCNRACKKDSSK KSSKRAKTQRRRKSFVKVMYENIH


    Database link: Q02445

  • Positive control

    • WB: Recombinant rat TFPI protein. HeLa and HepG2 cell lysate. IHC-P: Rat skin and stomach tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    Purified by TCS.
  • Clonality

    Monoclonal
  • Clone number

    C1
  • Isotype

    IgG2a
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab239516 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml.
IHC-P Use a concentration of 5 - 30 µg/ml.

Target

  • Function

    Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.
  • Tissue specificity

    Mostly in endothelial cells.
  • Sequence similarities

    Contains 3 BPTI/Kunitz inhibitor domains.
  • Domain

    This inhibitor contains three inhibitory domains. The first domain interacts with VIIa and TF, the second one with Xa.
  • Post-translational
    modifications

    O-glycosylated.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Anti convertin antibody
    • EPI antibody
    • Extrinsic pathway inhibitor antibody
    • LACI antibody
    • Lipoprotein associated coagulation inhibitor antibody
    • Lipoprotein-associated coagulation inhibitor antibody
    • TFI antibody
    • TFPI 1 antibody
    • TFPI antibody
    • TFPI1 antibody
    • TFPI1_HUMAN antibody
    • Tissue factor pathway inhibitor (lipoprotein associated coagulation inhibitor) antibody
    • Tissue factor pathway inhibitor antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat skin tissue stained for TFPI with ab239516 at 20 µg/ml in immunohistochemical analysis. DAB staining. HRP-Goat Anti-Mouse IgG secondary antibody used at 2 µg/ml.

  • Anti-TFPI antibody [C1] (ab239516) at 5 µg/ml + Recombinant rat TFPI protein
  • Formalin-fixed, paraffin-embedded rat stomach tissue stained for TFPI with ab239516 at 20 µg/ml in immunohistochemical analysis. DAB staining. HRP-Goat Anti-Mouse IgG secondary antibody used at 2 µg/ml.

  • Anti-TFPI antibody [C1] (ab239516) at 3 µg/ml + HepG2 (Human liver hepatocellular carcinoma cell line) cell lysate

    Secondary
    HRP-Goat Anti-Mouse IgG at 0.2 µg/ml

References

ab239516 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239516.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up