Overview

  • Product name
  • Description
    Rabbit polyclonal to TGDS
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Rat, Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human TGDS aa 143-305.
    Sequence:

    DEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITR SSNVYGPHQYPEKVIPKFISLLQHNRKCCIHGSGLQTRNFLYATDVVEAF LTVLKKGKPGEIYNIGTNFEMSVVQLAKELIQLIKETNSESEMENWVDYV NDRPTNDMRYPMK


    Database link: O95455

  • Positive control
    • WB: Rat liver tissue lysate. IHC: Human liver cancer and glioma cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Detects a band of approximately 41 kDa (predicted molecular weight: 40 kDa).

Target

Images

  • Anti-TGDS antibody (ab224599) at 1/500 dilution + Rat liver tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 40 kDa
    Observed band size: 41 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human liver cancer tissue stained for TGDS using ab224599 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human glioma cancer tissue stained for TGDS using ab224599 at 1/100 dilution in immunohistochemical analysis.

References

ab224599 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up