Overview

  • Product name
  • Description
    Rabbit polyclonal to TGDS
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human TGDS aa 258-343.
    Sequence:

    GTNFEMSVVQLAKELIQLIKETNSESEMENWVDYVNDRPTNDMRYPMKSE KIHGLGWRPKVPWKEGIKKTIEWYRENFHNWKNVEK


    Database link: O95455

  • Positive control
    • IHC-P: Human rectum tissue. WB: TGDS overexpression HEK-293T lysate. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab243735 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 40 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • PFA fixed, Triton X-100 permeabilized A431 (Human epidermoid carcinoma cell line) cells labeling TGDS using ab243735 at 4 µg/ml (green) in ICC/IF.

  • All lanes : Anti-TGDS antibody (ab243735) at 0.4 µg/ml

    Lane 1 : Vector only transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) lysate
    Lane 2 : TGDS overexpression HEK-293T lysate

    Predicted band size: 40 kDa

  • Formalin-fixed, paraffin-embedded human rectum tissue stained for TGDS with ab243735 at a 1/200 dilution in immunohistochemical analysis.

References

ab243735 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243735.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up