Overview

  • Product name

    Anti-TGE antibody - C-terminal
    See all TGE primary antibodies
  • Description

    Rabbit polyclonal to TGE - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human TGE aa 660-692 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    DILPSRSGTKQLLADFSCNKFPAIKAMLSIDVA


    Database link: Q08188

  • Positive control

    • Mouse embryo tissue.
  • General notes

    Protein previously labeled as Transglutaminase 3.

Properties

Applications

Our Abpromise guarantee covers the use of ab203229 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 77 kDa.
IHC-P 1/100 - 1/500.

(or 1/50  – 1/200 using a fluorescent secondary antibody).

Target

  • Function

    Catalyzes the calcium-dependent formation of isopeptide cross-links between glutamine and lysine residues in various proteins, as well as the conjugation of polyamines to proteins. Involved in the formation of the cornified envelope (CE), a specialized component consisting of covalent cross-links of proteins beneath the plasma membrane of terminally differentiated keratinocytes. Catalyzes small proline-rich proteins (SPRR1 and SPRR2) and LOR cross-linking to form small interchain oligomers, which are further cross-linked by TGM1 onto the growing CE scaffold (By similarity). In hair follicles, involved in cross-linking structural proteins to hardening the inner root sheath.
  • Sequence similarities

    Belongs to the transglutaminase superfamily. Transglutaminase family.
  • Post-translational
    modifications

    Activated by proteolytic processing. In vitro activation is commonly achieved by cleavage with dispase, a neutral bacterial protease. Dispase cleavage site was proposed to lie between Ser-470 and Ser-471 (PubMed:8099584) or between Pro-465 and Phe-466 (PubMed:16565075). Physiological activation may be catalyzed by CTSL and, to a lesser extent, by CTSS, but not by CTSB, CTSD nor CTSV (PubMed:16565075).
  • Information by UniProt
  • Database links

  • Alternative names

    • E polypeptide protein glutamine gamma glutamyltransferase antibody
    • MGC126249 antibody
    • MGC126250 antibody
    • Protein glutamine gamma glutamyltransferase E 27 kDa catalytic chain antibody
    • Protein glutamine gamma glutamyltransferase E 50 kDa noncatalytic chain antibody
    • Protein glutamine gamma glutamyltransferase E antibody
    • Protein-glutamine gamma-glutamyltransferase E 27 kDa non-catalytic chain antibody
    • TG(E) antibody
    • TGase E antibody
    • TGase-3 antibody
    • TGE antibody
    • TGM 3 antibody
    • TGM3 antibody
    • TGM3_HUMAN antibody
    • Transglutaminase E antibody
    • Transglutaminase-3 antibody
    • Transglutaminase3 antibody
    • TransglutaminaseE antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Mouse embryo tissue labeling TGE with ab203229 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

ab203229 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203229.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up