Overview

  • Product name

    Anti-TGF beta 1 antibody [TB21]
    See all TGF beta 1 primary antibodies
  • Description

    Mouse monoclonal [TB21] to TGF beta 1
  • Host species

    Mouse
  • Specificity

    ab190503 recognizes both human platelet-derived and recombinant TGF beta1 in enzyme-linked immunosorbent assay (ELISA). Mouse anti-Human TGF beta antibody, clone TB21 demonstrates neutralising activity against TGF beta1 in cell proliferation assays. Mouse anti Human TGF beta antibody, clone TB21 has been demonstrated to react with dimeric (25kD) or monomeric (12.5kD) molecules of natural TGF beta1 under non-reducing and reducing conditions respectively.
  • Tested applications

    Suitable for: IHC-Fr, WB, IHC-P, Flow Cytmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Sheep, Rabbit, Cow, Human, Mink
    Predicted to work with: Horse, Guinea pig, Dog, Pig
  • Immunogen

    Full length native protein (purified) corresponding to Human TGF beta aa 279-390. purified from platelets.
    Sequence:

    ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPY IWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQ LSNMIVRSCKCS


    Database link: P01137

  • Positive control

    • Human breast carcinoma and brain tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab190503 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 44 kDa.
IHC-P Use at an assay dependent concentration.

ab190503 has been used successfully on FFPE tissues without pretreatment. Citrate pH6.0, EDTA pH8.0 or pepsin mediated antigen retrieval have also been used.

Flow Cyt Use at an assay dependent concentration.

Membrane permeabilisation is required for this application. Use 10µl of the suggested working dilution to label 1x106 cells in 100µl.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

Target

  • Function

    Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts.
  • Tissue specificity

    Highly expressed in bone. Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA). Co-localizes with ASPN in chondrocytes within OA lesions of articular cartilage.
  • Involvement in disease

    Defects in TGFB1 are the cause of Camurati-Engelmann disease (CE) [MIM:131300]; also known as progressive diaphyseal dysplasia 1 (DPD1). CE is an autosomal dominant disorder characterized by hyperostosis and sclerosis of the diaphyses of long bones. The disease typically presents in early childhood with pain, muscular weakness and waddling gait, and in some cases other features such as exophthalmos, facial paralysis, hearing difficulties and loss of vision.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Post-translational
    modifications

    Glycosylated.
    The precursor is cleaved into mature TGF-beta-1 and LAP, which remains non-covalently linked to mature TGF-beta-1 rendering it inactive.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cartilage-inducing factor antibody
    • CED antibody
    • Differentiation inhibiting factor antibody
    • DPD1 antibody
    • LAP antibody
    • Latency-associated peptide antibody
    • Prepro transforming growth factor beta 1 antibody
    • TGF beta 1 antibody
    • TGF beta antibody
    • TGF beta 1 protein antibody
    • TGF-beta 1 protein antibody
    • TGF-beta-1 antibody
    • TGF-beta-5 antibody
    • TGF-beta1 antibody
    • TGFB antibody
    • Tgfb-1 antibody
    • tgfb1 antibody
    • TGFB1_HUMAN antibody
    • TGFbeta antibody
    • TGFbeta1 antibody
    • Transforming Growth Factor b1 antibody
    • Transforming Growth Factor beta 1 antibody
    • Transforming growth factor beta 1a antibody
    • transforming growth factor beta-1 antibody
    • transforming growth factor, beta 1 antibody
    • Transforming Growth Factor-ß1 antibody
    see all

Images

  • Immunohistochemical analysis of Human brain tissue labeling TGF beta with ab190503.

References

This product has been referenced in:

  • Seok J  et al. Effects of Intradermal Radiofrequency Treatment and Intense Pulsed Light Therapy in an Acne-induced Rabbit Ear Model. Sci Rep 9:5056 (2019). Read more (PubMed: 30911021) »
  • Huang L  et al. CD8+ T cells with high TGF-ß1 expression cause lymph node fibrosis following HIV infection. Mol Med Rep 18:77-86 (2018). Read more (PubMed: 29749506) »
See all 7 Publications for this product

Customer reviews and Q&As

Question
Answer



I recommend using two different dilutions for optimization. The purified Anti-TGF beta antibody [TB21] (ab190503) has a concentration of 50 µg at 1 mg/ml, which is why I recommend using 2µg/ml and 5µg/ml for the first experiment. In addition, please note that the optimal dilution of the antibody is dependent on the tissue and the pretreatment your customer will be using.


Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up