Overview

  • Product name

    Anti-TGF beta 2 antibody [RM0544-15M2]
    See all TGF beta 2 primary antibodies
  • Description

    Rat monoclonal [RM0544-15M2] to TGF beta 2
  • Host species

    Rat
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Chicken, Cow, Human, Pig, Xenopus laevis
  • Immunogen

    Recombinant fragment corresponding to Mouse TGF beta 2 aa 303-414.
    Sequence:

    ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPY LWSSDTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILYYIGNTPKIEQ LSNMIVKSCKCS


    Database link: P27090

  • Positive control

    • Mouse 3T3 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab205150 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 48 kDa.

Target

Images

  • Anti-TGF beta 2 antibody [RM0544-15M2] (ab205150) at 1/1000 dilution + Mouse 3T3 cell lysate

    Predicted band size: 48 kDa

References

ab205150 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205150.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up