Overview

  • Product name

    Anti-TGF beta Receptor III/TGFBR3 antibody [1C5H11]
    See all TGF beta Receptor III/TGFBR3 primary antibodies
  • Description

    Mouse monoclonal [1C5H11] to TGF beta Receptor III/TGFBR3
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Chimpanzee, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human TGF beta Receptor III/TGFBR3 aa 147-328.
    Sequence:

    ETEERNFPHGNEHLLNWARKEYGAVTSFTELKIARNIYIKVGEDQVFPPK CNIGKNFLSLNYLAEYLQPKAAEGCVMSSQPQNEEVHIIELITPNSNPYS AFQVDITIDIRPSQEDLEVVKNLILILKCKKSVNWVIKSFDVKGSLKIIA PNSIGFGKESERSMTMTKSIRDDIPSTQGNLV

  • Positive control

    • Recombinant Human TGF beta Receptor III/TGFBR3 protein; Jurkat, HeLa, MCF7, F9, SK N SH, NIH 3T3 cell lysates.
  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR206347-9 are from Tissue Culture Supernatant

     This product was previously labelled as TGF beta Receptor III

Properties

Applications

Our Abpromise guarantee covers the use of ab166705 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 93 kDa.
ELISA 1/10000.

Target

  • Function

    Binds to TGF-beta. Could be involved in capturing and retaining TGF-beta for presentation to the signaling receptors.
  • Sequence similarities

    Contains 1 ZP domain.
  • Post-translational
    modifications

    Extensively modified by glycosaminoglycan groups (GAG).
  • Cellular localization

    Secreted. Secreted > extracellular space. Cell membrane. Exists both as a membrane-bound form and as soluble form in serum and in the extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beta glycan antibody
    • Betaglycan antibody
    • Betaglycan proteoglycan antibody
    • BGCAN antibody
    • TGBR3_HUMAN antibody
    • TGF beta receptor type 3 antibody
    • TGF beta receptor type III antibody
    • TGF-beta receptor type 3 antibody
    • TGF-beta receptor type III antibody
    • TGFB R3 antibody
    • TGFBR 3 antibody
    • TGFBR3 antibody
    • TGFR 3 antibody
    • TGFR-3 antibody
    • TGFR3 antibody
    • Transforming growth factor beta receptor III antibody
    • Transforming growth factor beta receptor III betaglycan 300kDa antibody
    • Transforming growth factor beta receptor type 3 antibody
    see all

Images

  • Anti-TGF beta Receptor III/TGFBR3 antibody [1C5H11] (ab166705) at 1/500 dilution + recombinant Human TGF beta Receptor III/TGFBR3 protein

    Predicted band size: 93 kDa



    Expected MW of recombinant protein is 44.1 kDa.
  • All lanes : Anti-TGF beta Receptor III/TGFBR3 antibody [1C5H11] (ab166705) at 1/500 dilution

    Lane 1 : Jurkat cell lysate
    Lane 2 : HeLa cell lysate
    Lane 3 : MCF7 cell lysate
    Lane 4 : F9 cell lysate
    Lane 5 : SK N SH cell lysate
    Lane 6 : NIH 3T3 cell lysate

    Predicted band size: 93 kDa

  • ELISA using ab166705 at 1/10000 dilution
    Red: Control Antigen (100 ng)
    Purple: Antigen (10 ng)
    Green: Antigen (50 ng)
    Blue: Antigen (100 ng)

References

This product has been referenced in:

  • Roux SL  et al. Transforming Growth Factor Beta 1 Modulates the Functional Expression of the Neurokinin-1 Receptor in Human Keratocytes. Curr Eye Res 41:1035-1043 (2016). Read more (PubMed: 26673553) »
  • Zuckerwise L  et al. H19 long noncoding RNA alters trophoblast cell migration and invasion by regulating TßR3 in placentae with fetal growth restriction. Oncotarget 7:38398-38407 (2016). Read more (PubMed: 27223264) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166705.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up