Anti-TGFBRAP1 antibody (ab122468)
Key features and details
- Rabbit polyclonal to TGFBRAP1
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TGFBRAP1 antibody
See all TGFBRAP1 primary antibodies -
Description
Rabbit polyclonal to TGFBRAP1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human TGFBRAP1 aa 712-807 (internal sequence).
Sequence:RQQLFHTLLAIYLHAGPTAHELAVAAVDLLNRHATEFDAAQVLQMLPDTW SVQLLCPFLMGAMRDSIHARRTMQVALGLARSENLIYTYDKMKLKG
-
Positive control
- Human pancreas tissue; RT 4 and U 251 MG cell lysates.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab122468 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/10 - 1/20. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
|
WB |
Use a concentration of 0.04 - 0.4 µg/ml.
|
Notes |
---|
IHC-P
1/10 - 1/20. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
WB
Use a concentration of 0.04 - 0.4 µg/ml. |
Target
-
Function
Plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling. May recruit SMAD4 to the vicinity of the receptor complex and facilitate its interaction with receptor-regulated Smads, such as SMAD2. -
Sequence similarities
Belongs to the TRAP1 family.
Contains 1 CNH domain. -
Cellular localization
Cytoplasm. Colocalizes with TGF-beta receptors in the absence of signaling. - Information by UniProt
-
Database links
- Entrez Gene: 9392 Human
- Omim: 606237 Human
- SwissProt: Q8WUH2 Human
- Unigene: 446350 Human
-
Alternative names
- TGF-beta receptor-associated protein 1 antibody
- TGFA1_HUMAN antibody
- Tgfbrap1 antibody
see all
Images
-
ab122468, at 1/10 dilution, staining TGFBRAP1 in paraffin-embedded Human pancreas tissue by Immunohistochemistry.
-
All lanes : Anti-TGFBRAP1 antibody (ab122468) at 1/250 dilution
Lane 1 : RT 4 cell lysate
Lane 2 : U 251 MG cell lysate
Lane 3 : Human plasma lysate
Lane 4 : Human liver tissue lysate
Lane 5 : Human tonsil tissue lysate
Developed using the ECL technique.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab122468 has not yet been referenced specifically in any publications.