Anti-TGFBRAP1 antibody (ab122468)
Key features and details
- Rabbit polyclonal to TGFBRAP1
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TGFBRAP1 antibody
See all TGFBRAP1 primary antibodies -
Description
Rabbit polyclonal to TGFBRAP1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human TGFBRAP1 aa 712-807 (internal sequence).
Sequence:RQQLFHTLLAIYLHAGPTAHELAVAAVDLLNRHATEFDAAQVLQMLPDTW SVQLLCPFLMGAMRDSIHARRTMQVALGLARSENLIYTYDKMKLKG
-
Positive control
- Human pancreas tissue; RT 4 and U 251 MG cell lysates.
-
General notes
Previously labelled as TGF-beta receptor-associated protein 1.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab122468 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/10 - 1/20. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
WB | Use a concentration of 0.04 - 0.4 µg/ml. |
Target
-
Function
Plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling. May recruit SMAD4 to the vicinity of the receptor complex and facilitate its interaction with receptor-regulated Smads, such as SMAD2. -
Sequence similarities
Belongs to the TRAP1 family.
Contains 1 CNH domain. -
Cellular localization
Cytoplasm. Colocalizes with TGF-beta receptors in the absence of signaling. - Information by UniProt
-
Database links
- Entrez Gene: 9392 Human
- Omim: 606237 Human
- SwissProt: Q8WUH2 Human
- Unigene: 446350 Human
-
Alternative names
- TGF-beta receptor-associated protein 1 antibody
- TGFA1_HUMAN antibody
- Tgfbrap1 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TGFBRAP1 antibody (ab122468)
ab122468, at 1/10 dilution, staining TGFBRAP1 in paraffin-embedded Human pancreas tissue by Immunohistochemistry.
-
All lanes : Anti-TGFBRAP1 antibody (ab122468) at 1/250 dilution
Lane 1 : RT 4 cell lysate
Lane 2 : U 251 MG cell lysate
Lane 3 : Human plasma lysate
Lane 4 : Human liver tissue lysate
Lane 5 : Human tonsil tissue lysate
Developed using the ECL technique.
Protocols
Datasheets and documents
References (0)
ab122468 has not yet been referenced specifically in any publications.