Overview

  • Product name

  • Description

    Rabbit polyclonal to TGFBRAP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human TGFBRAP1 aa 479-578.
    Sequence:

    SAAWLEKHKKYFALGLLYHYNNQDAAAVQLWVNIVNGDVQDSTRSDLYEY IVDFLTYCLDEELVWAYADWVLQKSEEVGVQVFTKRPLDEQQKNSFNPDD


    Database link: Q8WUH2

  • Positive control

    • RT-4 cell lysate and human tonsil tissue lysate; A431 cells
  • General notes

    Previously labelled as TGF-beta receptor-associated protein 1.

Properties

Applications

Our Abpromise guarantee covers the use of ab220084 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 97 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling. May recruit SMAD4 to the vicinity of the receptor complex and facilitate its interaction with receptor-regulated Smads, such as SMAD2.
  • Sequence similarities

    Belongs to the TRAP1 family.
    Contains 1 CNH domain.
  • Cellular localization

    Cytoplasm. Colocalizes with TGF-beta receptors in the absence of signaling.
  • Information by UniProt
  • Database links

  • Alternative names

    • TGF-beta receptor-associated protein 1 antibody
    • TGFA1_HUMAN antibody
    • Tgfbrap1 antibody
    • Transforming growth factor-beta receptor-associated protein 1 antibody
    • TRAP-1 antibody
    • TRAP1 antibody
    • VPS3 antibody
    see all

Images

  • All lanes : Anti-TGFBRAP1 antibody (ab220084) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Human liver tissue lysate
    Lane 5 : Human tonsil tissue lysate

    Predicted band size: 97 kDa

  • Immunofluorescent analysis of PFA, triton X-100 permeabilized A431 cells labeling TGFBRAP1 using ab220084 at 4 μg/mL (green).

References

This product has been referenced in:

  • Han YL  et al. Downregulation of microRNA-193-3p inhibits the progression of intrahepatic cholangiocarcinoma cells by upregulating TGFBR3. Exp Ther Med 15:4508-4514 (2018). Read more (PubMed: 29725386) »
  • Li Q  et al. Exosomal miR-21-5p derived from gastric cancer promotes peritoneal metastasis via mesothelial-to-mesenchymal transition. Cell Death Dis 9:854 (2018). Read more (PubMed: 30154401) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220084.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up