Overview

  • Product name

  • Description

    Rabbit polyclonal to TGIF2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human TGIF2 aa 112-180.
    Sequence:

    SVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPG STLTLLTRAEAGSPTGGLF


    Database link: Q9GZN2

  • Positive control

    • ICC/IF: Caco-2 cells.
  • General notes

    Previously labelled as TGF beta induced factor 2. 

Properties

Applications

Our Abpromise guarantee covers the use of ab222131 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Transcriptional repressor, which probably repress transcription by binding directly the 5'-CTGTCAA-3' DNA sequence or by interacting with TGF-beta activated SMAD proteins. Probably represses transcription via the recruitment of histone deacetylase proteins.
  • Tissue specificity

    Widely expressed. Highly expressed in heart, kidney and testis. Weakly expressed in brain and prostate.
  • Sequence similarities

    Belongs to the TALE/TGIF homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Post-translational
    modifications

    The C-terminal part is phosphorylated in response to EGF signaling by the Ras/MAPK pathway.
  • Cellular localization

    Nucleus. Excluded from nucleoli.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5' TG 3' interacting factor 2 antibody
    • 5''-TG-3''-interacting factor 2 antibody
    • Homeobox protein TGIF2 antibody
    • TGF (beta) induced transcription factor 2 antibody
    • TGF beta induced factor 2 antibody
    • TGF-beta-induced transcription factor 2 antibody
    • TGFB induced factor 2 antibody
    • TGFB-induced factor 2 antibody
    • Tgif2 antibody
    • TGIF2_HUMAN antibody
    • Transforming growth factor beta induced factor 2 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized Caco-2 (human colorectal adenocarcinoma cell line) cells stained for TGIF2 (green) using ab222131 at 4 µg/ml in ICC/IF.

References

ab222131 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (E12.5 mouse embryo)
Specification
E12.5 mouse embryo
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 10% · Temperature: RT°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Feb 15 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up