Overview

  • Product name

    Anti-TGIF2LY antibody
  • Description

    Rabbit polyclonal to TGIF2LY
  • Host species

    Rabbit
  • Specificity

    ab200716 detects endogenous levels of TGIF2LY.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Synthetic peptide within Human TGIF2LY aa 140-185 (C terminal). The exact sequence is proprietary.
    Sequence:

    ASVPAKSGPVVQTMYKACPCGPCQRARCQERSNQIRSRPLARSSPE


    Database link: Q8IUE0

  • Positive control

    • MCF7, Jurkat and PC12 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab200716 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 21 kDa.

Target

  • Information by UniProt
  • Database links

  • Alternative names

    • Homeobox protein TGIF2LY antibody
    • TF2LY_HUMAN antibody
    • TGF(beta)induced transcription factor 2-like protein antibody
    • TGF-beta-induced transcription factor 2-like protein antibody
    • TGFB-induced factor 2-like protein antibody
    • TGFB-induced factor 2-like protein, Y-linked antibody
    • TGFB-induced factor homeobox 2-like, Y-linked antibody
    • TGIF-like on the Y antibody
    • TGIF2LY antibody
    • TGIFLY antibody
    • Transforming growth factor-beta-induced factor 2-like, Y-linked antibody
    • Y-linked antibody
    see all

Images

  • All lanes : Anti-TGIF2LY antibody (ab200716) at 1/500 dilution

    Lane 1 : MCF7 whole cell lysate
    Lane 2 : Jurkat whole cell lysate
    Lane 3 : PC12 whole cell lysate

    Predicted band size: 21 kDa

References

ab200716 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200716.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up