Overview

  • Product name

  • Description

    Rabbit polyclonal to TGIFLX
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla
  • Immunogen

    Recombinant fragment corresponding to Human TGIFLX aa 151-240.
    Sequence:

    PDNVQSLPLWPLPKGQMSREKQPDPESAPSQKLTGIAQPKKKVKVSVTSP SSPELVSPEEHADFSSFLLLVDAAVQRAAELELEKKQEPN


    Database link: Q8IUE1

  • Positive control

    • IHC-P: Human testis tissue. ICC/IF: SH-SY5Y cells.
  • General notes

     This product was previously labelled as TGIF2LX

     

Properties

Applications

Our Abpromise guarantee covers the use of ab224490 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May have a transcription role in testis.
  • Tissue specificity

    Specifically expressed in adult testis.
  • Sequence similarities

    Belongs to the TALE/TGIF homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Homeobox protein TGIF2LX antibody
    • MGC130458 antibody
    • testis expressed homeobox Tex1 antibody
    • Tex1 antibody
    • TF2LX_HUMAN antibody
    • TGF antibody
    • TGF beta induced transcription factor like protein antibody
    • TGF(beta) induced transcription factor 2 like antibody
    • TGF-beta-induced transcription factor 2-like protein antibody
    • TGFB induced factor 2 like protein X linked antibody
    • TGFB induced factor homeobox 2 like, X linked antibody
    • TGFB-induced factor 2-like protein antibody
    • TGIF homeobox 1 antibody
    • TGIF-like on the X antibody
    • TGIF2LX antibody
    • TGIFLX antibody
    • Tgifx1 antibody
    • X-linked antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for TGIFLX using ab224490 at 1/1000 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized SH-SY5Y (human neuroblastoma cell line from bone marrow) cells stained for TGIFLX (green) using ab224490 at 4 µg/ml in ICC/IF.

References

ab224490 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224490.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up