Overview

  • Product name

  • Description

    Rabbit polyclonal to TGIFLX
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla
  • Immunogen

    Synthetic peptide within Human TGIFLX aa 146-195 (internal sequence). The exact sequence is proprietary.
    Sequence:

    SGPSGPDNVQSLPLWPLPKGQMSREKQPDPESAPSQKLTGIAQPKKKVKV


    Database link: Q8IUE1

  • Positive control

    • HeLa cell lysate.
  • General notes

     This product was previously labelled as TGIF2LX

     

Properties

Applications

Our Abpromise guarantee covers the use of ab80423 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 27 kDa (predicted molecular weight: 27 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/62500.

Target

  • Function

    May have a transcription role in testis.
  • Tissue specificity

    Specifically expressed in adult testis.
  • Sequence similarities

    Belongs to the TALE/TGIF homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Homeobox protein TGIF2LX antibody
    • MGC130458 antibody
    • testis expressed homeobox Tex1 antibody
    • Tex1 antibody
    • TF2LX_HUMAN antibody
    • TGF antibody
    • TGF beta induced transcription factor like protein antibody
    • TGF(beta) induced transcription factor 2 like antibody
    • TGF-beta-induced transcription factor 2-like protein antibody
    • TGFB induced factor 2 like protein X linked antibody
    • TGFB induced factor homeobox 2 like, X linked antibody
    • TGFB-induced factor 2-like protein antibody
    • TGIF homeobox 1 antibody
    • TGIF-like on the X antibody
    • TGIF2LX antibody
    • TGIFLX antibody
    • Tgifx1 antibody
    • X-linked antibody
    see all

Images

  • Anti-TGIFLX antibody (ab80423) at 1 µg/ml + HeLa cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 27 kDa
    Observed band size: 27 kDa



    Gel concentration: 12%

References

ab80423 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab80423.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up