Overview

  • Product name

  • Description

    Rabbit polyclonal to TGM4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human TGM4 aa 1-684.
    Sequence:

    MMDASKELQVLHIDFLNQDNAVSHHTWEFQTSSPVFRRGQVFHLRLVLNQ PLQSYHQLKLEFSTGPNPSIAKHTLVVLDPRTPSDHYNWQATLQNESGKE VTVAVTSSPNAILGKYQLNVKTGNHILKSEENILYLLFNPWCKEDMVFMP DEDERKEYILNDTGCHYVGAARSIKCKPWNFGQFEKNVLDCCISLLTESS LKPTDRRDPVLVCRAMCAMMSFEKGQGVLIGNWTGDYEGGTAPYKWTGSA PILQQYYNTKQAVCFGQCWVFAGILTTVLRALGIPARSVTGFDSAHDTER NLTVDTYVNENGEKITSMTHDSVWNFHVWTDAWMKRPDLPKGYDGWQAVD ATPQERSQGVFCCGPSPLTAIRKGDIFIVYDTRFVFSEVNGDRLIWLVKM VNGQEELHVISMETTSIGKNISTKAVGQDRRRDITYEYKYPEGSSEERQV MDHAFLLLSSEREHRRPVKENFLHMSVQSDDVLLGNSVNFTVILKRKTAA LQNVNILGSFELQLYTGKKMAKLCDLNKTSQIQGQVSEVTLTLDSKTYIN SLAILDDEPVIRGFIIAEIVESKEIMASEVFTSFQYPEFSIELPNTGRIG QLLVCNCIFKNTLAIPLTDVKFSLESLGISSLQTSDHGTVQPGETIQSQI KCTPIKTGPKKFIVKLSSKQVKEINAQKIVLITK


    Database link: P49221

  • Positive control

    • IHC-P: Human prostate tissue. ICC/IF: SH-SY5Y cells.
  • General notes

    Previously labelled as Transglutaminase 7.

Properties

Applications

Our Abpromise guarantee covers the use of ab238563 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Associated with the mammalian reproductive process. Catalyzes the cross-linking of proteins and the conjugation of polyamines to specific proteins in the seminal tract.
  • Tissue specificity

    Prostate.
  • Sequence similarities

    Belongs to the transglutaminase superfamily. Transglutaminase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • Dorsal prostate transglutaminase antibody
    • Dorsal protein 1 antibody
    • Dp1 antibody
    • Fibrinoligase antibody
    • hTGP antibody
    • Prostate specific transglutaminase antibody
    • Prostate transglutaminase antibody
    • Prostate-specific transglutaminase antibody
    • Protein glutamine gamma glutamyltransferase 4 antibody
    • Protein-glutamine gamma-glutamyltransferase 4 antibody
    • TG(P) antibody
    • TGase P antibody
    • TGase-4 antibody
    • TGase4 antibody
    • Tgm4 antibody
    • TGM4_HUMAN antibody
    • TGP antibody
    • Transglutaminase 4 (prostate) antibody
    • Transglutaminase 4 antibody
    • Transglutaminase P antibody
    • Transglutaminase, prostate antibody
    • Transglutaminase-4 antibody
    see all

Images

  • Paraffin-embedded human prostate tissue stained for TGM4 using ab238563 at 1/300 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • SH-SY5Y (human neuroblastoma cell line from bone marrow) cells stained for TGM4 (green) using ab238563 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L). The nuclear counter stain is DAPI.

    The cells were fixed in 4% formaldehyde, permeabilized tissue using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C.

References

ab238563 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238563.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up