Overview

  • Product name

    Anti-TGT antibody
  • Description

    Rabbit polyclonal to TGT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human TGT aa 22-340.
    Sequence:

    ECSRSRARAGELWLPHGTVATPVFMPVGTQATMKGITTEQLDALGCRICL GNTYHLGLRPGPELIQKANGLHGFMNWPHNLLTDSGGFQMVSLVSLSEVT EEGVRFRSPYDGNETLLSPEKSVQIQNALGSDIIMQLDDVVSSTVTGPRV EEAMYRSIRWLDRCIAAHQRPDKQNLFAIIQGGLDADLRATCLEEMTKRD VPGFAIGGLSGGESKSQFWRMVALSTSRLPKDKPRYLMGVGYATDLVVCV ALGCDMFDCVFPTRTARFGSALVPTGNLQLRKKVFEKDFGPIDPECTCPT CQKHSRAFLHALLHSDNTA


    Database link: Q9BXR0

  • Positive control

    • WB: NTERA-2 cl.D1 [NT2/D1] and PC-3 whole cell lysates. IHC-P: Human kidney tissue.
  • General notes

     This product was previously labelled as QTRT1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.00
    Preservative: 0.01% Thimerosal (merthiolate)
    Constituents: 1.21% Tris, 0.75% Glycine, 20% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230430 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/3000. Predicted molecular weight: 44 kDa.
IHC-P Use a concentration of 5 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.

Target

  • Function

    Interacts with QTRTD1 to form an active queuine tRNA-ribosyltransferase. This enzyme exchanges queuine for the guanine at the wobble position of tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr), thereby forming the hypermodified nucleoside queuosine (Q) (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).
  • Pathway

    tRNA modification; tRNA-queuosine biosynthesis.
  • Sequence similarities

    Belongs to the queuine tRNA-ribosyltransferase family.
  • Cellular localization

    Cytoplasm. Mitochondrion. Nucleus. Weakly associates with mitochondria, possibly via QTRTD1.
  • Information by UniProt
  • Database links

  • Alternative names

    • FP3235 antibody
    • Guanine insertion enzyme antibody
    • qtrt1 antibody
    • Queuine tRNA ribosyltransferase 1 antibody
    • Queuine tRNA ribosyltransferase antibody
    • Queuine tRNA-ribosyltransferase antibody
    • TGT antibody
    • TGT, 43 KD subunit antibody
    • TGT, catalytic subunit antibody
    • TGT_HUMAN antibody
    • TGUT antibody
    • tRNA guanine transglycosylase antibody
    • tRNA-guanine transglycosylase antibody
    see all

Images

  • All lanes : Anti-TGT antibody (ab230430) at 1/1000 dilution

    Lane 1 : NTERA-2 cl.D1 [NT2/D1] (human malignant pluripotent embryonic carcinoma cell line) whole cell lysate
    Lane 2 : PC-3 (human prostate adenocarcinoma cell line) whole cell lysate

    Lysates/proteins at 30 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 44 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for TGT with ab230430 at 5 μg/ml in immunohistochemical analysis.

References

ab230430 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230430.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up