Overview

  • Product name

  • Description

    Rabbit polyclonal to TH1L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Pig, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human TH1L aa 346-590.
    Sequence:

    ARINQDHKHKYIHILAYAASVVETWKKNKRVSINKDELKSTSKAVETVHN LCCNENKGASELVAELSTLYQCIRFPVVAMGVLKWVDWTVSEPRYFQLQT DHTPVHLALLDEISTCHQLLHPQVLQLLVKLFETEHSQLDVMEQLELKKT LLDRMVHLLSRGYVLPVVSYIRKCLEKLDTDISLIRYFVTEVLDVIAPPY TSDFVQLFLPILENDSIAGTIKTEGEHDPVTEFIAHCKSNFIMVN


    Database link: Q8IXH7-1

  • Positive control

    • IHC-P: Human adrenal gland tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab238111 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II. The NELF complex, which acts via an association with the DSIF complex and causes transcriptional pausing, is counteracted by the P-TEFb kinase complex.
  • Tissue specificity

    Widely expressed. Expressed in heart, brain, lung, placenta, liver, skeletal and cardiac muscle, adrenal, thyroid, kidney and pancreas.
  • Sequence similarities

    Belongs to the NELF-D family.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • HSPC130 antibody
    • Negative elongation factor C/D antibody
    • NELF C antibody
    • NELF D antibody
    • NELF-C/D antibody
    • NELFC antibody
    • NELFD antibody
    • NELFD_HUMAN antibody
    • TH1 antibody
    • TH1-like protein antibody
    • TH1L antibody
    see all

Images

  • Paraffin-embedded human adrenal gland tissue stained for TH1L using ab238111 at 1/100 dilution in immunohistochemical analysis.

References

ab238111 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238111.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up