Overview

  • Product name

    Anti-THAP1 antibody
  • Description

    Rabbit polyclonal to THAP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human THAP1 aa 127-206.
    Sequence:

    VNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQ LEKLKEVVHFQKEKDDVSERGYVILPNDYF


    Database link: Q9NVV9

  • Positive control

    • ICC/IF: RH-30 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222196 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    DNA-binding transcription regulator that regulates endothelial cell proliferation and G1/S cell-cycle progression. Specifically binds the 5'-[AT]NTNN[GT]GGCA[AGT]-3' core DNA sequence and acts by modulating expression of pRB-E2F cell-cycle target genes, including RRM1. May also have pro-apoptopic activity by potentiating both serum-withdrawal and TNF-induced apoptosis.
  • Involvement in disease

    Defects in THAP1 are the cause of dystonia type 6 (DYT6) [MIM:602629]. DYT6 is a primary torsion dystonia. Dystonia is defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. Dystonia type 6 is characterized by onset in early adulthood, cranial or cervical involvement in about half of the cases, and frequent progression to involve multiple body regions.
  • Sequence similarities

    Belongs to the THAP1 family.
    Contains 1 THAP-type zinc finger.
  • Cellular localization

    Nucleus > nucleoplasm. Nucleus > PML body.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4833431A01Rik antibody
    • DYT6 antibody
    • FLJ10477 antibody
    • MGC33014 antibody
    • Nuclear proapoptotic factor antibody
    • THAP 1 antibody
    • THAP domain containing 1 antibody
    • THAP domain containing apoptosis associated protein 1 antibody
    • THAP domain containing protein 1 antibody
    • THAP domain protein 1 antibody
    • THAP domain-containing protein 1 antibody
    • Thap1 antibody
    • THAP1_HUMAN antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized RH-30 cells stained for THAP1 (green) using ab222196 at 4 µg/ml in ICC/IF.

References

ab222196 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222196.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up