Anti-THIK-1 antibody (ab237624)
Key features and details
- Rabbit polyclonal to THIK-1
- Suitable for: WB, IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-THIK-1 antibody -
Description
Rabbit polyclonal to THIK-1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human THIK-1 aa 292-408.
Sequence:RKMDSGCCPQCQRGLLRSRRNVVMPGSVRNRCNISIETDGVAESDTDGRR LSGEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGV GAFAIMNNRLAETSGDR
Database link: Q9HB14 -
Positive control
- WB: LO2 and HepG2 whole cell lysate. IHC-P: Human skeletal muscle and glioma tissue. ICC/IF: HepG2 cells.
-
General notes
Previously labelled as KCNK13.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol (glycerin, glycerine), PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity greater than 95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab237624 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/2000. Predicted molecular weight: 45 kDa. | |
IHC-P | 1/20 - 1/200. | |
ICC/IF | 1/50 - 1/200. |
Target
-
Function
Potassium channel displaying weak inward rectification in symmetrical K(+) solution. -
Sequence similarities
Belongs to the two pore domain potassium channel (TC 1.A.1.8) family. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 56659 Human
- Omim: 607367 Human
- SwissProt: Q9HB14 Human
- Unigene: 510191 Human
-
Alternative names
- K2p13.1 antibody
- K2P13.1 potassium channel antibody
- Kcnk13 antibody
see all
Images
-
All lanes : Anti-THIK-1 antibody (ab237624) at 1/500 dilution
Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
Lane 2 : LO2 (human immortal liver cell line) whole cell lysate
Secondary
All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution
Predicted band size: 45 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-THIK-1 antibody (ab237624)
Paraffin-embedded human skeletal muscle tissue stained for THIK-1 with ab237624 at a 1/100 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-THIK-1 antibody (ab237624)
Paraffin-embedded human glioma tissue stained for THIK-1 with ab237624 at a 1/100 dilution in immunohistochemical analysis.
-
HepG2 (human liver hepatocellular carcinoma cell line) cells stained for THIK-1 using ab237624 at a dilution of 1/100 in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab237624 has not yet been referenced specifically in any publications.