Overview

  • Product name

    Anti-Thioredoxin / TRX antibody
    See all Thioredoxin / TRX primary antibodies
  • Description

    Rabbit polyclonal to Thioredoxin / TRX
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Sheep, Horse, Cow, Pig, Rhesus monkey, Orangutan
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human Thioredoxin/ TRX aa 1-105. N-terminal tag. Expressed in E. coli.
    Sequence:

    MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYS NVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEAT INELV


    Database link: P10599-1

  • Positive control

    • WB: Recombinant human Thioredoxin / TRX protein. HepG2, HeLa and MCF7 cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231735 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 12 kDa.

Target

  • Function

    Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.
    ADF augments the expression of the interleukin-2 receptor TAC (IL2R/P55).
  • Sequence similarities

    Belongs to the thioredoxin family.
    Contains 1 thioredoxin domain.
  • Post-translational
    modifications

    In the fully reduced protein, both Cys-69 and Cys-73 are nitrosylated in response to nitric oxide (NO). When two disulfide bonds are present in the protein, only Cys-73 is nitrosylated. Cys-73 can serve as donor for nitrosylation of target proteins.
    In case of infection, ubiquitinated by S.typhimurium protein slrP, leading to its degradation.
  • Cellular localization

    Nucleus. Cytoplasm. Secreted. Secreted by a leaderless secretory pathway. Predominantly in the cytoplasm in non irradiated cells. Radiation induces translocation of TRX from the cytoplasm to the nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • ADF antibody
    • ATL derived factor antibody
    • ATL-derived factor antibody
    • DKFZp686B1993 antibody
    • MGC61975 antibody
    • SASP antibody
    • Surface associated sulphydryl protein antibody
    • Surface-associated sulphydryl protein antibody
    • testicular tissue protein Li 199 antibody
    • THIO_HUMAN antibody
    • Thioredoxin antibody
    • thioredoxin delta 3 antibody
    • TRDX antibody
    • TRX 1 antibody
    • Trx antibody
    • TRX1 antibody
    • TXN antibody
    • TXN delta 3 antibody
    • TXN protein antibody
    • zgc:92903 antibody
    see all

Images

  • All lanes : Anti-Thioredoxin / TRX antibody (ab231735) at 2 µg/ml

    Lane 1 : HepG2 (Human liver hepatocellular carcinoma cell line) cell lysate
    Lane 2 : MCF7 (Human breast adenocarcinoma cell line) cell lysate
    Lane 3 : HeLa (Human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 12 kDa

  • Anti-Thioredoxin / TRX antibody (ab231735) at 2 µg/ml + Recombinant human Thioredoxin/ TXR protein

    Predicted band size: 12 kDa

References

ab231735 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231735.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up