Overview

  • Product name

    Anti-Thioredoxin 2 antibody
    See all Thioredoxin 2 primary antibodies
  • Description

    Rabbit polyclonal to Thioredoxin 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Thioredoxin 2 aa 1-166.
    Sequence:

    MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPAR TIYTTRISLTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRL EKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVG IKDEDQLEAFLKKLIG


    Database link: Q99757

  • Positive control

    • IHC-P: Human tonsil, colon and pancreatic tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab236298 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    Thioredoxins (Trx) are small, multi-functional proteins with oxidoreductase activity and are ubiquitous in essentially all living cells. Trx contains a redox-active disulfide/dithiol group within the conserved Cys-Gly-Pro-Cys active site. The two cysteine residues in the conserved active centers can be oxidized to form intramolecular disulfide bonds. Reduction of the active site disulfide in oxidized Trx is catalyzed by Trx reductase with NADPH as the electron donor. The reduced Trx is a hydrogen donor for ribonucleotide reductase, the essential enzyme for DNA synthesis, and a potent general protein disulfide reductase with numerous functions in growth and redox regulations. Specific protein disulfide targets for reduction by Trx include protein disulfide isomerase(PDI) and a number of transcription factors such as p53, NF-kB and AP-1. Trx is also capable of removing H2O2, particularly when it is coupled with either methionine sulfoxide reductase or several isoforms of peroxiredoxins.
  • Cellular localization

    Mitochondrial
  • Database links

  • Alternative names

    • mitochondrial thioredoxin antibody
    • MT-TRX antibody
    • MTRX antibody
    • thioredoxin 2 precursor antibody
    • Thioredoxin mitochondrial antibody
    • Thioredoxin2 antibody
    • TRX 2 antibody
    • TRX2 antibody
    • TXN 2 antibody
    • TXN2 antibody
    see all

Images

  • Paraffin-embedded human tonsil tissue stained for Thioredoxin 2 using ab236298 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon tissue stained for Thioredoxin 2 using ab236298 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreatic tissue stained for Thioredoxin 2 using ab236298 at 1/100 dilution in immunohistochemical analysis.

References

ab236298 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236298.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up