Overview

  • Product name

  • Description

    Rabbit polyclonal to THOC5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human THOC5 aa 314-449.
    Sequence:

    SDAEEEQTTKRRRPTLGVQLDDKRKEMLKRHPLSVMLDLKCKDDSVLHLT FYYLMNLNIMTVKAKVTTAMELITPISAGDLLSPDSVLSCLYPGDHGKKT PNPANQYQFDKVGILTLSDYVLELGHPYLWVQKLGG


    Database link: Q13769

  • Positive control

    • RT4 cell lysate; U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221049 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100
WB 1/100 - 1/250. Predicted molecular weight: 79 kDa.

Target

  • Function

    Component the THO subcomplex of the TREX complex. The TREX complex specifically associates with spliced mRNA and not with unspliced pre-mRNA. It is recruited to spliced mRNAs by a transcription-independent mechanism. Binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export. The recruitment occurs via an interaction between ALYREF/THOC4 and the cap-binding protein NCBP1. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production. The recruitment of the TREX complex to the intronless viral mRNA occurs via an interaction beteen KSHV ORF57 protein and ALYREF/THOC4. DDX39B functions as a bridge between ALYREF/THOC4 and the THO complex. THOC5 in conjunction with ALYREF/THOC4 functions in NXF1-NXT1 mediated nuclear export of HSP70 mRNA. Regulates the expression of myeloid transcription factors CEBPA, CEBPB and GAB2 by enhancing the levels of phosphatidylinositol 3,4,5-trisphosphate. May be involved in the differentiation of granulocytes and adipocytes. Essential for hematopoietic primitive cell survival and plays an integral role in monocytic development.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the THOC5 family.
  • Post-translational
    modifications

    Phosphorylated on tyrosine upon binding to activated CSF1R; which causes a dissociation of the two proteins. Phosphorylation on Ser-5 and/or Ser-6 is required for nuclear export. Phosphorylated on Thr-328 in insulin-stimulated adipocytes (By similarity). Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Cytoplasm. Shuttles between nucleus and cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • C22orf19 antibody
    • Chromosome 22 open reading frame 19 antibody
    • Fmip antibody
    • Fms interacting protein antibody
    • fSAP79 antibody
    • Functional spliceosome-associated protein 79 antibody
    • hTREX90 antibody
    • KIAA0983 antibody
    • LOC400922 antibody
    • NF2/meningioma region protein pK1.3 antibody
    • PK1.3 antibody
    • Placental protein 39.2 antibody
    • PP39.2 antibody
    • THO complex 5 antibody
    • THO complex subunit 5 antibody
    • THO complex subunit 5 homolog antibody
    • thoc5 antibody
    • THOC5_HUMAN antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed/Triton X-100 permeabilized U-2 OS cells labeling THOC5 with ab221049 at 4 μg/ml (green).

  • Anti-GPCR GPR40 antibody (ab211049) at 1/100 dilution + RT4 cell lysate

    Predicted band size: 79 kDa

References

ab221049 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221049.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up