Overview

  • Product name

  • Description

    Rabbit polyclonal to THOC7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Fusion protein corresponding to Human THOC7 aa 1-204. (BC065012; The identity of the protein fusion partner is GST).
    Sequence:

    MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQY QRMLSTLSQCEFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKIA ECKKQILQAKRIRKNRQEYDALAKVIQHHPDRHETLKELEALGKELEHLS HIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMET DPKP


    Database link: Q6I9Y2

  • Positive control

    • Mouse spleen, Human fetal liver and Mouse testis tissue lysates; HeLa and A431 cell lysates; Human lung cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab199150 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/25 - 1/100.
WB 1/500 - 1/2000. Predicted molecular weight: 24 kDa.

Target

  • Function

    Component of the THO subcomplex of the TREX complex. The TREX complex specifically associates with spliced mRNA and not with unspliced pre-mRNA. It is recruited to spliced mRNAs by a transcription-independent mechanism. Binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export. The recruitment occurs via an interaction between ALYREF/THOC4 and the cap-binding protein NCBP1. DDX39B functions as a bridge between ALYREF/THOC4 and the THO complex. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production. The recruitment of the TREX complex to the intronless viral mRNA occurs via an interaction between KSHV ORF57 protein and ALYREF/THOC4.
  • Sequence similarities

    Belongs to the THOC7 family.
  • Cellular localization

    Cytoplasm. Nucleus. Interaction with THOC5 is required for nuclear localization.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ23445 antibody
    • fSAP24 antibody
    • Functional spliceosome associated protein 24 antibody
    • Functional spliceosome-associated protein 24 antibody
    • hTREX30 antibody
    • Ngg1 interacting factor 3 like 1 binding protein 1 antibody
    • Ngg1 interacting factor 3 like protein 1 binding protein 1 antibody
    • Ngg1-interacting factor 3-like protein 1-binding protein 1 antibody
    • NIF3L1 binding protein 1 antibody
    • NIF3L1-binding protein 1 antibody
    • NIF3L1BP1 antibody
    • THO complex 7 homolog (Drosophila) antibody
    • THO complex 7 homolog antibody
    • THO complex subunit 7 homolog antibody
    • THOC 7 antibody
    • thoc7 antibody
    • THOC7_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human lung cancer tissue labeling THOC7 with ab199150 at 1/30 dilution.

  • All lanes : Anti-THOC7 antibody (ab199150) at 1/500 dilution

    Lane 1 : Mouse spleen lysate
    Lane 2 : Human fetal liver lysate
    Lane 3 : HeLa cell lysate
    Lane 4 : Mouse testis lysate
    Lane 5 : A431 cell lysate

    Lysates/proteins at 40 µg per lane.

    Predicted band size: 24 kDa


    Exposure time: 15 seconds


    Gel: 10% SDS-PAGE.

References

ab199150 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab199150.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up