Overview

  • Product name

  • Description

    Rabbit polyclonal to Thorase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human Thorase aa 289-350.
    Sequence:

    QETDGFSGSDLKEMCRDAALLCVREYVNSTSEESHDEDEIRPVQQQDLHR AIEKMKKSKDAA


    Database link: Q8NBU5

  • Positive control

    • WB: HeLa whole cell lysate; Rat brain tissue lysate; Mouse kidney and brain tissue lysate. IHC-P: Human prostate cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229706 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 41 kDa.

Target

  • Function

    ATPase that plays a critical role in regulating the surface expression of AMPA receptors (AMPAR), thereby regulating synaptic plasticity and learning and memory. Required for NMDA-stimulated AMPAR internalization and inhibition of GRIA1 and GRIA2 recycling back to the plasma membrane; these activities are ATPase-dependent.
  • Sequence similarities

    Belongs to the AAA ATPase family.
  • Cellular localization

    Peroxisome. Cell junction, synapse, postsynaptic cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4921525H23Rik antibody
    • AAA+ ATPase Thorase antibody
    • Ab2-088 antibody
    • AFDC1 antibody
    • Atad1 antibody
    • ATAD1_HUMAN antibody
    • ATPase family AAA domain containing protein 1 antibody
    • ATPase family AAA domain-containing protein 1 antibody
    • ATPase family, AAA domain containing 1 antibody
    • ATPase Thorase antibody
    • AW107648 antibody
    • FLJ14600 antibody
    • FNP001 antibody
    • Thorase antibody
    see all

Images

  • All lanes : Anti-Thorase antibody (ab229706) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : Rat brain tissue lysate
    Lane 3 : Mouse kidney tissue lysate
    Lane 4 : Mouse brain tissue lysate

    Secondary
    All lanes : Goat anti-rabbit IgG at 1/50000 dilution

    Predicted band size: 41 kDa

  • Paraffin-embedded human prostate cancer tissue stained for Thorase using ab229706 at 1/100 dilution in immunohistochemical analysis.

References

ab229706 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229706.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up