Overview

  • Product name
  • Description
    Rabbit polyclonal to ThPok
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide within Human ThPok aa 313-362 (internal sequence). The exact sequence is proprietary.
    Sequence:

    DLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKIIHGAGKLP


    Database link: O15156

  • Positive control
    • HepG2 cell lysate, Human heart and human lung tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab23388 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 2 µg/ml. Predicted molecular weight: 60 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use at an assay dependent concentration.

Target

  • Function
    Transcription regulator that acts as a key regulator of lineage commitment of immature T-cell precursors. Necessary and sufficient for commitment of CD4 lineage, while its absence causes CD8 commitment. Development of immature T-cell precursors (thymocytes) to either the CD4 helper or CD8 killer T-cell lineages correlates precisely with their T-cell receptor specificity for major histocompatibility complex class II or class I molecules, respectively. Transcriptional repressor of the collagen COL1A1 and COL1A2 genes. May also function as a repressor of fibronectin and possibly other extracellular matrix genes.
  • Sequence similarities
    Contains 1 BTB (POZ) domain.
    Contains 4 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • c Krox antibody
    • cKrox antibody
    • DKFZp686G01254 antibody
    • hc Krox antibody
    • hcKrox antibody
    • Krueppel-related zinc finger protein cKrox antibody
    • Kruppel related zinc finger protein c Krox antibody
    • Kruppel related zinc finger protein cKrox antibody
    • Kruppel related zinc finger protein hcKrox antibody
    • T helper inducing POZ/Kruppel like factor antibody
    • T-helper-inducing POZ/Krueppel-like factor antibody
    • Th-POK antibody
    • ThPOK antibody
    • ZBT7B_HUMAN antibody
    • ZBTB 15 antibody
    • ZBTB 7B antibody
    • ZBTB15 antibody
    • ZBTB7B antibody
    • ZFP 67 antibody
    • Zfp-67 antibody
    • ZFP67 antibody
    • Zinc finger and BTB domain containing 15 antibody
    • Zinc finger and BTB domain containing 7B antibody
    • Zinc finger and BTB domain containing protein 15 antibody
    • Zinc finger and BTB domain containing protein 7B antibody
    • Zinc finger and BTB domain-containing protein 15 antibody
    • Zinc finger and BTB domain-containing protein 7B antibody
    • Zinc finger protein 67 homolog antibody
    • Zinc finger protein 857B antibody
    • Zinc finger protein Th POK antibody
    • Zinc finger protein Th-POK antibody
    • Zinc finger protein ThPOK antibody
    • ZNF857B antibody
    see all

Images

  • Western blot analysis of Human fetal liver tissue lysate labeling ThPok with ab23388 at 1.0µg/ml.
  • Anti-ThPok antibody (ab23388) + HepG2 cell lysate (20ug)

    Secondary
    HRP conjugated anti-Rabbit IgG diluted in 1: 50,000 - 100,000.

    Predicted band size: 60 kDa
    Observed band size: 60 kDa



    ab23388 titration 0.004ug/ml.
  • Immunohistochemical analysis of ThPok expression in paraffin embedded human heart tissue section. ab23388 was used at 4 ug/ml. Arrows indicate the positively labelled myocardial cells.

  • Immunohistochemical analysis of ThPok expression in paraffin embedded human lung tissue section. ab23388 was used at 4 ug/ml. Arrows indicate the positively labelled alveolar cells.

  • All lanes : Anti-ThPok antibody (ab23388) at 1.25 µg/ml

    Lane 1 : HepG2 cell lysate
    Lane 2 : HepG2 cell lysate with blocking peptide at 1 µg/ml

    Lysates/proteins at 25 µg per lane.

    Predicted band size: 60 kDa

References

ab23388 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-6 of 6 Abreviews or Q&A

Abreviews
Application
Flow Cytometry
Fixation
eBioscience transcription factor fixation buffer
Permeabilization
Yes - eBioscience transcription factor permeabilization buffer
Sample
Human Cell (Thymocytes and PBMCs)
Specification
Thymocytes and PBMCs
Gating Strategy
Lymphocytes - doublet exclusion - CD4+ vs. CD8+
Preparation
Cell harvesting/tissue preparation method: meshed/Ficoll
Sample buffer: PBS/BSA

Abcam user community

Verified customer

Submitted Jun 23 2014

Answer

The better choice will be ab70991, as the immunogen is 100% conserved in rat ThPok. The immunogen for ab23388 is conserved 85%, so reactivity is predicted, but is less probable than ab70991 reactivity.

Read More

Answer

Thank you for sending this information.

If you would like, I can issue free of charge replacements of the antibody and lysate with another anti-ThPok antibody such as ab23388 or ab70991 and our recommended positive control lysate. Like ab93922, these antibodies will be covered by our Abpromise guarantee for use in WB on human tissues.

As neither antibody has been tested in FACS, I would be glad to also enroll either of these products in our AbTrial program for that application. Here is a brief description of how this program works:

The testing discount program is for customers who like to use an antibody/protein on an untested species/application. You would purchase the antibody at full price (in this case I would be providing a product as a free of charge replacement), test it and submit an Abreview with your data (positive or negative). On your next order you will receive a discount for ONE antibody at the full price (100%) of the antibody you have tested. The terms and conditions applicable to this offer can be found here:https://www.abcam.com/AbTrial

We feel that an HRP- ECL detection system will generally be adequate for use with our WB tested products unless stated on the datasheet. We do not have specific FACS recommendations as we have not yet tested these in that application. I can recommend a starting concentration of 1ug/ml; however the optimal concentration will have to be found experimentally. Our direct and indirect FACS protocols may be found at the following locations:

Direct:https://www.abcam.com/index.html?pageconfig=resource&rid=11380

Indirect:https://www.abcam.com/index.html?pageconfig=resource&rid=11381

More protocol information may be found at:

https://www.abcam.com/index.html?pageconfig=popular_protocols

I hope this information is helpful to you and look forward to hearing how you would like to proceed. Please do not hesitate to contact us if you need any more advice or information.

Use our products? Submit an Abreview. Earn rewards!
https://www.abcam.com/abreviews

Read More

Answer

Thank you for your enquiry.

I am sorry to confirm that non of our thPok antibodies have been tested and guaranteed in Xenopus tropicalis. I have checked the alignment of the sequence you kindly provided with the immunogen sequences for the antibodies we have. Regrettably, these all show very low alignment which means the antibodies are very unlikely to detect in Xenopus tropicalis.

I am sorry this is not better news and that we do not have antibodies that would meet your requirements on this occasion.

If you have any further questions, please do not hesitate to contact us.

Read More

Answer

Thank you for your enquiry. We do not routinely offer free or trial sized samples for testing purposes. Our policy at Abcam is that if an antibody does not work as specified on the datasheet, we will offer a replacement or reimbursement. To our knowledge, this antibody has not yet been tested with murine samples. However, I did a sequence alignment of the amino acid range listed for the immunogen and the murine sequence, and found that there is 85% homology within that range, with long stretches of matching amino acids. So it is possible that the antibody will cross-react. Should you decide to go ahead and purchase this product, please let us know how you get on by submitting an Abreview and in return we will offer you 50 Abpoints which can be redeemed on a number of rewards (a further 100 Abpoints will be offered for an image). I hope this information helps, please do not hesitate to contact us if you need any more advice or information.

Read More

Answer

Thank you for your phone call. The sequence of the synthetic peptide used for immunization is as follows: AQGGGPPLSPEELGSDEDAIDPDLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMP. It represents a part of a region from AA residue 291 to AA residue 345 of ZFP67 (NP_056956 in NCBI database). If you have any additional questions, please contact us again.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up