Overview

  • Product name

    Anti-Thrombomodulin antibody
    See all Thrombomodulin primary antibodies
  • Description

    Rabbit polyclonal to Thrombomodulin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human Thrombomodulin aa 200-500.
    Sequence:

    RGADFQALPVGSSAAVAPLGLQLMCTAPPGAVQGHWAREAPGAWDCSVEN GGCEHACNAIPGAPRCQCPAGAALQADGRSCTASATQSCNDLCEHFCVPN PDQPGSYSCMCETGYRLAADQHRCEDVDDCILEPSPCPQRCVNTQGGFEC HCYPNYDLVDGECVEPVDPCFRANCEYQCQPLNQTSYLCVCAEGFAPIPH EPHRCQMFCNQTACPADCDPNTQASCECPEGYILDDGFICTDIDECENGG FCSGVCHNLPGTFECICGPDSALARHIGTDCDSGKVDGGDSGSGEPPPSP T


    Database link: P07204

  • Positive control

    • WB: Rat heart tissue lysate; mouse heart, kidney and brain tissue lysates; HepG2, A549 and A431 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab230189 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 60 kDa (predicted molecular weight: 60 kDa).

Target

  • Function

    Thrombomodulin is a specific endothelial cell receptor that forms a 1:1 stoichiometric complex with thrombin. This complex is responsible for the conversion of protein C to the activated protein C (protein Ca). Once evolved, protein Ca scissions the activated cofactors of the coagulation mechanism, factor Va and factor VIIIa, and thereby reduces the amount of thrombin generated.
  • Tissue specificity

    Endothelial cells are unique in synthesizing thrombomodulin.
  • Involvement in disease

    Defects in THBD are the cause of thrombophilia due to thrombomodulin defect (THR-THBD) [MIM:188040]. A hemostatic disorder characterized by a tendency to thrombosis.
    Defects in THBD are a cause of susceptibility to hemolytic uremic syndrome atypical type 6 (AHUS6) [MIM:612926]. An atypical form of hemolytic uremic syndrome. It is a complex genetic disease characterized by microangiopathic hemolytic anemia, thrombocytopenia, renal failure and absence of episodes of enterocolitis and diarrhea. In contrast to typical hemolytic uremic syndrome, atypical forms have a poorer prognosis, with higher death rates and frequent progression to end-stage renal disease. Note=Susceptibility to the development of atypical hemolytic uremic syndrome can be conferred by mutations in various components of or regulatory factors in the complement cascade system. Other genes may play a role in modifying the phenotype.
  • Sequence similarities

    Contains 1 C-type lectin domain.
    Contains 6 EGF-like domains.
  • Post-translational
    modifications

    N-glycosylated.
    The iron and 2-oxoglutarate dependent 3-hydroxylation of aspartate and asparagine is (R) stereospecific within EGF domains.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AHUS 6 antibody
    • AHUS6 antibody
    • BDCA 3 antibody
    • BDCA3 antibody
    • CD 141 antibody
    • CD141 antibody
    • CD141 antigen antibody
    • Fetomodulin antibody
    • Thbd antibody
    • THPH12 antibody
    • THRM antibody
    • Thrombomodulin antibody
    • TM antibody
    • TRBM_HUMAN antibody
    see all

Images

  • All lanes : Anti-Thrombomodulin antibody (ab230189) at 1/1000 dilution

    Lane 1 : Rat heart lysate
    Lane 2 : Mouse kidney lysate
    Lane 3 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 4 : A431 (human epidermoid carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat anti-Rabbit IgG at 1/10000 dilution

    Predicted band size: 60 kDa
    Observed band size: 60 kDa

  • All lanes : Anti-Thrombomodulin antibody (ab230189) at 1/1000 dilution

    Lane 1 : Mouse heart lysate
    Lane 2 : Mouse kidney lysate
    Lane 3 : Mouse brain lysate
    Lane 4 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat anti-Rabbit IgG at 1/10000 dilution

    Predicted band size: 60 kDa
    Observed band size: 60 kDa

References

This product has been referenced in:

  • Shan X  et al. Edoxaban improves atrial fibrillation and thromboembolism through regulation of the Wnt-ß-induced PI3K/ATK-activated protein C system. Exp Ther Med 17:3509-3517 (2019). Read more (PubMed: 30988731) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230189.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up