Anti-Thrombomodulin antibody (ab233286)
Key features and details
- Rabbit polyclonal to Thrombomodulin
- Suitable for: WB, IHC-P
- Reacts with: Human, Pig
- Isotype: IgG
Overview
-
Product name
Anti-Thrombomodulin antibody
See all Thrombomodulin primary antibodies -
Description
Rabbit polyclonal to Thrombomodulin -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human, Pig -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Human Thrombomodulin aa 31-169. (Expressed in E.coli).
Sequence:VEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAADVISLLLNGDGG VGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGA PLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEF
Database link: P07204 -
Positive control
- IHC-P: Human kidney tissue. WB: Recombinant human Thrombomodulin protein; Human lung lysate; Pig heart lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab233286 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab233286 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 60 kDa. | |
IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Thrombomodulin is a specific endothelial cell receptor that forms a 1:1 stoichiometric complex with thrombin. This complex is responsible for the conversion of protein C to the activated protein C (protein Ca). Once evolved, protein Ca scissions the activated cofactors of the coagulation mechanism, factor Va and factor VIIIa, and thereby reduces the amount of thrombin generated. -
Tissue specificity
Endothelial cells are unique in synthesizing thrombomodulin. -
Involvement in disease
Defects in THBD are the cause of thrombophilia due to thrombomodulin defect (THR-THBD) [MIM:188040]. A hemostatic disorder characterized by a tendency to thrombosis.
Defects in THBD are a cause of susceptibility to hemolytic uremic syndrome atypical type 6 (AHUS6) [MIM:612926]. An atypical form of hemolytic uremic syndrome. It is a complex genetic disease characterized by microangiopathic hemolytic anemia, thrombocytopenia, renal failure and absence of episodes of enterocolitis and diarrhea. In contrast to typical hemolytic uremic syndrome, atypical forms have a poorer prognosis, with higher death rates and frequent progression to end-stage renal disease. Note=Susceptibility to the development of atypical hemolytic uremic syndrome can be conferred by mutations in various components of or regulatory factors in the complement cascade system. Other genes may play a role in modifying the phenotype. -
Sequence similarities
Contains 1 C-type lectin domain.
Contains 6 EGF-like domains. -
Post-translational
modificationsN-glycosylated.
The iron and 2-oxoglutarate dependent 3-hydroxylation of aspartate and asparagine is (R) stereospecific within EGF domains. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 7056 Human
- Omim: 188040 Human
- SwissProt: P07204 Human
- Unigene: 2030 Human
-
Alternative names
- AHUS 6 antibody
- AHUS6 antibody
- BDCA 3 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Thrombomodulin antibody (ab233286)
Formalin-fixed, paraffin-embedded human kidney tissue stained for Thrombomodulin using ab233286 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
All lanes : Anti-Thrombomodulin antibody (ab233286) at 3 µg/ml
Lane 1 : Pig heart lysate
Lane 2 : Human lung lysate
Secondary
Lane 1 : HRP-Linked Guinea pig Anti-Rabbit Ab at 1/1000 dilution
Lane 2 : HRP-Linked Guinea pig Anti-Rabbit at 1/1000 dilution
Predicted band size: 60 kDa -
Anti-Thrombomodulin antibody (ab233286) at 2 µg/ml + Recombinant human Thrombomodulin protein.
Predicted band size: 60 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab233286 has not yet been referenced specifically in any publications.