Overview

  • Product name

    Anti-Thrombospondin antibody
    See all Thrombospondin primary antibodies
  • Description

    Rabbit polyclonal to Thrombospondin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Rat Thrombospondin aa 71-259. (Expressed in E.coli).
    Sequence:

    PDDKFQDLLDAVWADKGFIFLASLRQMKKTRGTLLAVERKDNSGQIFSVV SNGKAGTLDLSLSLPGKQQVVSVEEALLATGQWKSITLFVQEDRAQLYID CDKMESAELDVPIQSIFTRDLANVARLRVAKGDVNDNFQGVLQNVRFVFG TTPEDILRNKGCSSSTNVLLTLDNNVVNGSSPAIRTNYI


    Database link: Q71SA3

  • Positive control

    • IHC-P: Rat brain and spleen tissues. WB: Human urine; Rat serum; Recombinant rat Thrombospondin protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231115 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 130 kDa.

Target

Images

  • Formalin-fixed, paraffin-embedded rat brain tissue stained for Thrombospondin using ab231115 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat brain tissue stained for Thrombospondin using ab231115 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Thrombospondin antibody (ab231115) at 2 µg/ml + Recombinant rat Thrombospondin protein

    Predicted band size: 130 kDa

  • Anti-Thrombospondin antibody (ab231115) at 5 µg/ml + Human urine

    Predicted band size: 130 kDa

  • Anti-Thrombospondin antibody (ab231115) at 5 µg/ml + Rat serum

    Predicted band size: 130 kDa

References

ab231115 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231115.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up