Overview

  • Product name

    Anti-Thromboxane A2 receptor/TBXA2R antibody
    See all Thromboxane A2 receptor/TBXA2R primary antibodies
  • Description

    Rabbit polyclonal to Thromboxane A2 receptor/TBXA2R
  • Host species

    Rabbit
  • Tested applications

    Suitable for: Immunoelectrophoresis, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: African green monkey
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Thromboxane A2 receptor/TBXA2R aa 3-324. Two N-terminal tags. Expressed in E.coli.
    Sequence:

    PNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGA RQGGSHTRSSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGC RLCRFMGVVMIFFGLSPLLLGAAMASERYLGITRPFSRPAVASQRRAWAT VGLVWAAALALGLLPLLGVGRYTVQYPGSWCFLTLGAESGDVAFGLLFSM LGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSEVEMMAQLLGIMV VASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWNQI LDPWVYILFRRAVLRRLQPRLS


    Database link: P21731

  • Positive control

    • IHC-P: Human pancreatic cancer and kidney tissues; WB: Recombinant human Thromboxane A2 receptor/TBXA2R; Rat kidney lysate.
  • General notes

     This product was previously labelled as Thromboxane A2 receptor

     

Properties

Applications

Our Abpromise guarantee covers the use of ab233288 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Immunoelectrophoresis Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Receptor for thromboxane A2 (TXA2), a potent stimulator of platelet aggregation. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. In the kidney, the binding of TXA2 to glomerular TP receptors causes intense vasoconstriction. Activates phospholipase C. Isoform 1 activates adenylyl cyclase. Isoform 2 inhibits adenylyl cyclase.
  • Involvement in disease

    Defects in TBXA2R are the cause of susceptibility to bleeding disorder platelet-type 13 (BDPLT13) [MIM:614009]. BDPLT13 is a disorder characterized by reduced platelet aggregation and a tendency to mild mucocutaneous bleeding.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • BDPLT13 antibody
    • Prostanoid TP receptor antibody
    • TA2R_HUMAN antibody
    • Tbxa2r antibody
    • Thromboxane A2 receptor antibody
    • TP receptor antibody
    • TXA2 R antibody
    • TXA2-R antibody
    • TXA2R antibody
    see all

Images

  • Anti-Thromboxane A2 receptor/TBXA2R antibody (ab233288) at 1 µg/ml + Rat kidney tissue lysate

    Secondary
    HRP-linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml
  • Formalin-fixed, paraffin-embedded human kidney tissue stained for Thromboxane A2 receptor/TBXA2R using ab233288 at 20 µg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded human pancreatic cancer tissue stained for Thromboxane A2 receptor/TBXA2R using ab233288 at 20 µg/mL in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Anti-Thromboxane A2 receptor/TBXA2R antibody (ab233288) at 1 µg/ml + Recombinant human Thromboxane A2 receptor/TBXA2R

References

ab233288 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233288.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up