Overview

  • Product name

  • Description

    Rabbit polyclonal to THRSP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human THRSP aa 58-142.
    Sequence:

    TYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGEL DLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMT


    Database link: Q92748

  • Positive control

    • IHC: Human cerebral cortext tissue. ICC/IF: A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224168 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA (By similarity). May function as transcriptional coactivator. May modulate the transcription factor activity of THRB.
  • Tissue specificity

    Mainly expressed in tissues that synthesize triglycerides.
  • Sequence similarities

    Belongs to the SPOT14 family.
  • Cellular localization

    Nucleus. Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Lpgp antibody
    • LPGP1 antibody
    • MGC21659 antibody
    • OTTHUMP00000233866 antibody
    • S14 antibody
    • S14 protein antibody
    • SPOT 14 antibody
    • Spot 14 protein antibody
    • SPOT14 antibody
    • SPOT14 homolog antibody
    • Thrsp antibody
    • THRSP_HUMAN antibody
    • Thyroid hormone inducible hepatic protein antibody
    • Thyroid hormone responsive (SPOT14 homolog rat) antibody
    • Thyroid hormone responsive antibody
    • Thyroid hormone responsive protein antibody
    • Thyroid hormone responsive SPOT14 antibody
    • Thyroid hormone-inducible hepatic protein antibody
    see all

Images

  • Paraffin-embedded human cerebral cortex tissue stained for THRSP using ab224168 at 1/200 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for THRSP (green) using ab224168 at 4 µg/ml in ICC/IF.

References

ab224168 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224168.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up