Anti-THUMPD1 antibody (ab199850)
Key features and details
- Rabbit polyclonal to THUMPD1
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-THUMPD1 antibody -
Description
Rabbit polyclonal to THUMPD1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IPmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Chimpanzee -
Immunogen
Synthetic peptide within Human THUMPD1 aa 303-353 (C terminal). The exact sequence is proprietary. (NP_060206.2).
Sequence:GKNNQQVPENTEELGQTKPTSNPQVVNEGGAKPELASQATEGSKSNENDF S
Database link: Q9NXG2 -
Positive control
- HeLa, 293T and Jurkat cell lysate
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab199850 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/2000 - 1/10000. Predicted molecular weight: 39 kDa. | |
IP | Use at 2-10 µg/mg of lysate. |
Target
-
Sequence similarities
Belongs to the THUMPD1 family.
Contains 1 THUMP domain. - Information by UniProt
-
Database links
- Entrez Gene: 55623 Human
- SwissProt: Q9NXG2 Human
- Unigene: 741402 Human
-
Alternative names
- DKFZp686C1054 antibody
- FLJ20274 antibody
- THUM1_HUMAN antibody
see all
Images
-
All lanes : Anti-THUMPD1 antibody (ab199850) at 0.1 µg/ml
Lane 1 : HeLa cell lysate
Lane 2 : 293T cell lysate
Lane 3 : Jurkat cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 39 kDa
Exposure time: 10 secondsLysates prepared using NETN lysis buffer.
-
Detection of THUMPD1 in immunoprecipitates of 293T whole cell lysates prepared using NETN lysis buffer (1 mg for IP, 20% of IP loaded) using ab199850 at 6 µg/mg lysate for IP (Lane 1) and at 0.4 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.
Detection: Chemiluminescence with an exposure time of 10 seconds.
Protocols
Datasheets and documents
References (0)
ab199850 has not yet been referenced specifically in any publications.