Overview

  • Product name

  • Description

    Rabbit polyclonal to Thy1.1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, Flow Cytmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Sheep, Human
  • Immunogen

    Synthetic peptide within Rat Thy1.1 aa 30-80 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    VNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVN L


    Database link: P01830

  • Positive control

    • IHC-P: Rat brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203022 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Flow Cyt 1/50.

Target

  • Relevance

    CD90 (Thy1) antigen is a GPI linked glycoprotein member of the Immunoglobulin superfamily. It is expressed on murine T cells, thymocytes, neural cells, cells of granulocytic lineage, early hematopoietic progenitors, fibroblasts, neurons and Kupffer's cells. Thy1 may play a role in cell to cell or cell to ligand interactions during synaptogenesis and other events in the brain. It is found in most mouse strains except AKR/J, A, Thy1.1 and B6.PL (74NS) expressing Thy1.1.
  • Cellular localization

    Attached to the membrane by a GPI anchor.
  • Database links

  • Alternative names

    • CD90 antibody
    • CD90.1 antibody
    • CDw90 antibody
    • Thy 1 cell surface antigen antibody
    • Thy 1 membrane glycoprotein antibody
    • Thy 1.1 antibody
    • Thy1 antibody
    • Thymus cell antigen 1, theta antibody
    see all

Images

  • Flow Cytometry of Mouse Kidney with ab217798 at 1/50
  • Immunohistochemical analysis of formalin/PFA-fixed paraffin-embedded rat brain tissue labeling Thy1.1 using ab203022 at a 1/200 dilution. DAB staining, followed by conjugation to the secondary antibody and DAB staining.

References

This product has been referenced in:

  • Vigneswara V & Ahmed Z Pigment epithelium-derived factor mediates retinal ganglion cell neuroprotection by suppression of caspase-2. Cell Death Dis 10:102 (2019). Read more (PubMed: 30718480) »
See 1 Publication for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (spleen)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Citrate and Tris-EDTA
Permeabilization
Yes - 0.1/Tween20/PBS
Specification
spleen
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 10% · Temperature: 24°C
Fixative
4% Histofix

Abcam user community

Verified customer

Submitted Jan 12 2018

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (spleen)
Permeabilization
Yes - 0.05% Triton X100
Specification
spleen
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 23°C
Fixative
Acetone:Methanol 1:1

Dr. jonatan tuncel

Verified customer

Submitted Jan 09 2018

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (Thy1.1 cells in Mouse PDA)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: pH 6, pH 8, and trypsin enyme (Ventana reagents)
Permeabilization
No
Specification
Thy1.1 cells in Mouse PDA
Blocking step
(agent) for 8 minute(s) · Concentration: 3% · Temperature: 37°C
Fixative
10% NBF

Abcam user community

Verified customer

Submitted Mar 31 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up