Overview

  • Product name

    Anti-Thymidine Kinase 1/TK1 antibody [C1]
    See all Thymidine Kinase 1/TK1 primary antibodies
  • Description

    Mouse monoclonal [C1] to Thymidine Kinase 1/TK1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Thymidine Kinase 1/TK1 aa 2-234. Two N-terminal tags, His-tag and GST-tag (Expressed in E.coli).
    Sequence:

    SCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCL VIKYAKDTRYSSSFCTHDRNTMEALPACLLRDVAQEALGVAVIGIDEGQF FPDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVVKLTA VCMECFREAAYTKRLGTEKEVEVIGGADKYHSVCRLCYFKKASGQPAGPD NKENCPVPGKPGEAVAARKLFAPQQILQCSPAN


    Database link: P04183

  • Positive control

    • IHC-P: Human uterine fibroids tissue. ICC/IF: MCF7 cells. WB: HeLa cell lysate; Recombinant human Thymidine Kinase 1/TK1 protein.
  • General notes

     This product was previously labelled as Thymidine Kinase 1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Clone number

    C1
  • Isotype

    IgG2b
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab239509 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 25 kDa.
ICC/IF Use a concentration of 5 - 30 µg/ml.
IHC-P Use a concentration of 5 - 30 µg/ml.

Target

  • Sequence similarities

    Belongs to the thymidine kinase family.
  • Post-translational
    modifications

    Phosphorylated on Ser-13 in mitosis.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • cytosolic antibody
    • KITH_HUMAN antibody
    • Thymidine kinase 1 antibody
    • Thymidine kinase 1 soluble antibody
    • Thymidine kinase 1 soluble isoform antibody
    • Thymidine kinase antibody
    • Thymidine kinase cytosolic antibody
    • TK 1 antibody
    • TK 2 antibody
    • TK1 antibody
    • Tk1a antibody
    • Tk1b antibody
    • TK2 antibody
    see all

Images

  • Anti-Thymidine Kinase 1/TK1 antibody [C1] (ab239509) at 5 µg/ml + Recombinant human Thymidine Kinase 1/TK1 protein

    Predicted band size: 25 kDa

  • Paraffin-embedded human uterine fibroids tissue stained for Thymidine Kinase 1/TK1 using ab239509 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • MCF7 (human breast adenocarcinoma cell line) cells stained for Thymidine Kinase 1/TK1 (green) using ab239509 at 30 µg/ml in ICC/IF, followed by FITC staining.

  • Anti-Thymidine Kinase 1/TK1 antibody [C1] (ab239509) at 6 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 25 kDa

References

ab239509 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239509.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up