Overview

  • Product name

    Anti-TIE1 antibody [8D12B10]
    See all TIE1 primary antibodies
  • Description

    Mouse monoclonal [8D12B10] to TIE1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TIE1 aa 385-607.
    Sequence:

    IELRKPDGTVLLSTKAIVEPEKTTAEFEVPRLVLADSGFWECRVSTSGGQ DSRRFKVNVK VPPVPLAAPRLLTKQSRQLVVSPLVSFSGDGPISTVRLHYRPQDSTMDWS TIVVDPSENV TLMNLRPKTGYSVRVQLSRPGEGGEGAWGPPTLMTTDCPEPLLQPWLEGW HVEGTDRLRV SWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSPQARTALL


    Database link: P35590

  • Positive control

    • TIE1 transfected HEK293 cell lysate. HepG2 cell lysate. Human liver cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab201977 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 125 kDa.
ELISA 1/10000.

Target

  • Function

    Transmembrane tyrosine-protein kinase that may modulate TEK/TIE2 activity and contribute to the regulation of angiogenesis.
  • Tissue specificity

    Specifically expressed in developing vascular endothelial cells.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. Tie subfamily.
    Contains 3 EGF-like domains.
    Contains 3 fibronectin type-III domains.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residues in response to ANGPT1, most likely by TEK/TIE2.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • JKT 14 antibody
    • JTK14 antibody
    • TIE antibody
    • Tie1 antibody
    • TIE1_HUMAN antibody
    • Tyrosine kinase with immunoglobulin and epidermal growth factor homology domains 1 antibody
    • Tyrosine Kinase with Immunoglobulin and Epidermal Growth Factor Homology Domains antibody
    • Tyrosine kinase with immunoglobulin-like and EGF-like domains 1 antibody
    • Tyrosine protein kinase receptor Tie 1 antibody
    • Tyrosine-protein kinase receptor Tie-1 antibody
    see all

Images

  • Anti-TIE1 antibody [8D12B10] (ab201977) at 1/500 dilution + human recombinant TIE1 protein

    Predicted band size: 125 kDa

  • All lanes : Anti-TIE1 antibody [8D12B10] (ab201977) at 1/500 dilution

    Lane 1 : Non-transfected HEK293 cell lysate
    Lane 2 : TIE1 transfected HEK293 cell lysate

    Predicted band size: 125 kDa

  • Anti-TIE1 antibody [8D12B10] (ab201977) at 1/500 dilution + HepG2 cell lysate

    Predicted band size: 125 kDa

  • Immunohistochemical analysis of paraffin-embedded human liver cancer tissues labeling TIE1 using ab201977 at 1/200 dilution followed by DAB staining.

References

ab201977 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201977.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up