Overview

  • Product name

  • Description

    Rabbit polyclonal to TIE1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human TIE1 aa 850-900 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    FGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPN I


    Database link: P35590

  • Positive control

    • Human brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab203078 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 125 kDa.
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 using a fluorescent secondary antibody).

Target

  • Function

    Transmembrane tyrosine-protein kinase that may modulate TEK/TIE2 activity and contribute to the regulation of angiogenesis.
  • Tissue specificity

    Specifically expressed in developing vascular endothelial cells.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. Tie subfamily.
    Contains 3 EGF-like domains.
    Contains 3 fibronectin type-III domains.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residues in response to ANGPT1, most likely by TEK/TIE2.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • JKT 14 antibody
    • JTK14 antibody
    • TIE antibody
    • Tie1 antibody
    • TIE1_HUMAN antibody
    • Tyrosine kinase with immunoglobulin and epidermal growth factor homology domains 1 antibody
    • Tyrosine Kinase with Immunoglobulin and Epidermal Growth Factor Homology Domains antibody
    • Tyrosine kinase with immunoglobulin-like and EGF-like domains 1 antibody
    • Tyrosine protein kinase receptor Tie 1 antibody
    • Tyrosine-protein kinase receptor Tie-1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human brain tissue labeling TIE1 with ab203078 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203078 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203078.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up