Overview

  • Product name

  • Description

    Rabbit polyclonal to TIGIT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse TIGIT aa 28-246. Two N-terminal tags. Expressed in E.coli.
    Sequence:

    GTIDTKRNISAEEGGSVILQCHFSSDTAEVTQVDWKQQDQLLAIYSVDLG WHVASVFSDRVVPGPSLGLTFQSLTMNDTGEYFCTYHTYPGGIYKGRIFL KVQESSDDRNGLAQFQTAPLGGTMAAVLGLICLMVTGVTVLARKDKSIRM HSIESGLGRTEAEPQEWNLRSLSSPGSPVQTQTAPAGPCGEQAEDDYADP QEYFNVLSYRSLESFIAVS


    Database link: P86176

  • Positive control

    • WB: Recombinant mouse TIGIT protein; Mouse spleen lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233404 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 5 µg/ml.

Target

  • Function

    Binds with high affinity to the poliovirus receptor (PVR) which causes increased secretion of IL10 and decreased secretion of IL12B and suppresses T cell activation by promoting the generation of mature immunoregulatory dendritic cells.
  • Tissue specificity

    Expressed at low levels on peripheral memory and regulatory CD4+ T cells and NK cells and is up-regulated following activation of these cells (at protein level).
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain

    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp667A205 antibody
    • ENSMUSG00000071552 antibody
    • FLJ39873 antibody
    • RGD1563191 antibody
    • T cell immunoreceptor with Ig and ITIM domains antibody
    • TIGIT antibody
    • TIGIT_HUMAN antibody
    • V-set and immunoglobulin domain containing 9 antibody
    • V-set and immunoglobulin domain-containing protein 9 antibody
    • V-set and transmembrane domain containing 3 antibody
    • V-set and transmembrane domain-containing protein 3 antibody
    • VSIG9 antibody
    • VSTM3 antibody
    • Washington University cell adhesion molecule antibody
    • WUCAM antibody
    see all

Images

  • Anti-TIGIT antibody (ab233404) at 3 µg/ml + Mouse spleen tissue lysate

    Secondary
    HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution
  • Anti-TIGIT antibody (ab233404) at 2 µg/ml + Recombinant mouse TIGIT protein

References

This product has been referenced in:

  • Tang W  et al. Clinical significance of CD8+ T cell immunoreceptor with Ig and ITIM domains+ in locally advanced gastric cancer treated with SOX regimen after D2 gastrectomy. Oncoimmunology 8:e1593807 (2019). Read more (PubMed: 31069158) »
  • Stålhammar G  et al. Expression of immune checkpoint receptors Indoleamine 2,3-dioxygenase and T cell Ig and ITIM domain in metastatic versus nonmetastatic choroidal melanoma. Cancer Med 8:2784-2792 (2019). Read more (PubMed: 30993893) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233404.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up