Overview

  • Product name

  • Description

    Rabbit polyclonal to TIL/TLR1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cytmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide within Human TIL/TLR1 aa 400-450 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    LQQLDISQNSVSYDEKKGDCSWTKSLLSLNMSSNILTDTIFRCLPPRIKV L


    Database link: Q15399

  • Positive control

    • Human small intestine tissue; Human PBMCs; Ramos and Raw cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab189337 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 3 µg/ml. Predicted molecular weight: 90 kDa.
IHC-P Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
Flow Cyt Use 0.5µg for 106 cells.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function

    Participates in the innate immune response to microbial agents. Cooperates with TLR2 to mediate the innate immune response to bacterial lipoproteins or lipopeptides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
  • Tissue specificity

    Ubiquitous. Highly expressed in spleen, ovary, peripheral blood leukocytes, thymus and small intestine.
  • Sequence similarities

    Belongs to the Toll-like receptor family.
    Contains 12 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 TIR domain.
  • Cellular localization

    Cell membrane. Cytoplasmic vesicle > phagosome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD281 antibody
    • CD281 antigen antibody
    • KIAA0012 antibody
    • LPRS5 antibody
    • rsc786 antibody
    • TIL antibody
    • TIL. LPRS5 antibody
    • Tlr1 antibody
    • TLR1_HUMAN antibody
    • Toll (Drosophila) homolog antibody
    • Toll like receptor 1 antibody
    • Toll-like receptor 1 antibody
    • Toll/interleukin-1 receptor-like protein antibody
    see all

Images

  • All lanes : Anti-TIL/TLR1 antibody (ab189337) at 2 µg/ml

    Lane 1 : Ramos cell lysate
    Lane 2 : Raw cell lysate
    Lane 3 : TIL/TLR1 transfected HEK293 cell lysate

    Secondary
    All lanes : Goat anti-rabbit HRP

    Predicted band size: 90 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human small intestine tissue labeling TIL/TLR1 with ab189337 at 10 µg/ml.

  • Flow cytometric analysis of Human PBMCs (monocyte-gated) labeling TIL/TLR1 with ab189337 at 0.5 µg/106 cells. Shaded histogram represents cells without antibody, green represents isotype control, red represents ab189337. Goat anti-rabbit PE secondary antibody was used.

References

This product has been referenced in:

  • Salyer ACD & David SA Transcriptomal signatures of vaccine adjuvants and accessory immunostimulation of sentinel cells by toll-like receptor 2/6 agonists. Hum Vaccin Immunother 14:1686-1696 (2018). Read more (PubMed: 29852079) »
  • Huhta H  et al. The Expression of Toll-like Receptors in Normal Human and Murine Gastrointestinal Organs and the Effect of Microbiome and Cancer. J Histochem Cytochem 64:470-82 (2016). Read more (PubMed: 27370795) »
See all 2 Publications for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Application
Western blot
Sample
Human Cell lysate - whole cell (ARPE-19, retina pigment epithelial cells)
Gel Running Conditions
Reduced Denaturing (4-15%)
Loading amount
100 µg
Specification
ARPE-19, retina pigment epithelial cells
Blocking step
Milk as blocking agent for 1 hour(s) and 30 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Jan 09 2017

Application
Western blot
Sample
Cynomolgus monkey Tissue lysate - whole (Macaque neural retina lysate)
Gel Running Conditions
Reduced Denaturing (4-15%)
Loading amount
200 µg
Specification
Macaque neural retina lysate
Blocking step
Milk as blocking agent for 1 hour(s) and 30 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Jan 09 2017

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Cynomolgus monkey Tissue sections (macaque retina)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: citrate pH 6
Permeabilization
No
Specification
macaque retina
Blocking step
(agent) for 30 minute(s) · Concentration: 5% · Temperature: 25°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Jan 09 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up