Overview

  • Product name

    Anti-TIM 1 antibody [3A12E10]
    See all TIM 1 primary antibodies
  • Description

    Mouse monoclonal [3A12E10] to TIM 1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TIM 1 aa 70-290. (Expressed in E.coli).
    Sequence:

    TYRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKIT VSLEIVPPKVTTTPIVTTVPTVTTVRTSTTVPTTTTVPTTTVPTTMSIPT TTTVLTTMTVSTTTSVPTTTSIPTTTSVPVTTTVSTFVPPMPLPRQNHEP VATSPSSPQPAETHPTTLQGAIRREPTSSPLYSYTTDGNDTVTESSDGLW NNNQTQLFLEHSLLTANTTKG


    Database link: Q96D42

  • Positive control

    • WB: Recombinant human TIM 1 (aa70-290) protein; TIM 1 (aa70-290)-hIgG-Fc-transfected HEK-293 cell lysate. Flow cyt: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab233714 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 39 kDa.
Flow Cyt 1/200 - 1/400.

Target

  • Function

    May play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4 (By similarity). In case of human hepatitis A virus (HHAV) infection, functions as a cell-surface receptor for the virus. May play a role in kidney injury and repair.
  • Tissue specificity

    Widely expressed, with highest levels in kidney and testis. Expressed by activated CD4+ T-cells during the development of helper T-cells responses.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. TIM family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD365 antibody
    • HAVCR 1 antibody
    • HAVCR antibody
    • HAVcr-1 antibody
    • Havcr1 antibody
    • Hepatitis A virus cellular receptor 1 antibody
    • Kidney injury molecule 1 antibody
    • KIM 1 antibody
    • KIM-1 antibody
    • T cell immunoglobin domain and mucin domain protein 1 antibody
    • T cell immunoglobulin mucin family member 1 antibody
    • T cell immunoglobulin mucin receptor 1 antibody
    • T-cell immunoglobulin and mucin domain-containing protein 1 antibody
    • T-cell membrane protein 1 antibody
    • TIM antibody
    • TIM-1 antibody
    • TIM1 antibody
    • TIMD 1 antibody
    • TIMD-1 antibody
    • TIMD1 antibody
    • TIMD1_HUMAN antibody
    see all

Images

  • Anti-TIM 1 antibody [3A12E10] (ab233714) at 1/500 dilution + Recombinant human TIM 1 (aa70-290) protein

    Predicted band size: 39 kDa



    Expected MW is 37 kDa.

  • All lanes : Anti-TIM 1 antibody [3A12E10] (ab233714) at 500 cells

    Lane 1 : Non-transfected HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : TIM 1 (aa70-290)-hIgG-Fc-transfected HEK-293 cell lysate

    Predicted band size: 39 kDa

  • Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling KIM1 with ab233714 at 1/200 dilution (green) compared with a negative control (red).

References

ab233714 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233714.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up