Anti-TIM 3 antibody (ab185703)

Rabbit polyclonal TIM 3 antibody. Validated in WB, IHC and tested in Mouse, Rat, Human. Cited in 9 publication(s). Independently reviewed in 2 review(s).

Overview

  • Product name

  • Description

    Rabbit polyclonal to TIM 3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human TIM 3 aa 22-202. Extracellular domain.
    Sequence:

    SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTD ERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDE KFNLKLVIKPAKVTPAPTRQRDFTAAFPRMLTTRGHGPAETQTLGSLPDI NLTQISTLANELRDSRLANDLRDSGATIRIG


    Database link: Q8TDQ0

  • Positive control

    • WB: HepG2, BxPC-3, BT-474, U937, A-549, THP-1 cell lysates. Mouse spleen, lung and thymus. Rat spleen. IHC-P: Human lung cancer tissue, human tonsil tissue and mouse spleen tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab185703 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 33 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Target

  • Function

    Cell surface receptor implicated in modulating innate and adaptive immune responses. Generally accepted to have an inhibiting function. Reports on stimulating functions suggest that the activity may be influenced by the cellular context and/or the respective ligand (PubMed:24825777). Regulates macrophage activation (PubMed:11823861). Inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and promotes immunological tolerance (PubMed:14556005). In CD8+ cells attenuates TCR-induced signaling, specifically by blocking NF-kappaB and NFAT promoter activities resulting in the loss of IL-2 secretion. The function may implicate its association with LCK proposed to impair phosphorylation of TCR subunits, and/or LGALS9-dependent recruitment of PTPRC to the immunological synapse (PubMed:24337741, PubMed:26492563). In contrast, shown to activate TCR-induced signaling in T-cells probably implicating ZAP70, LCP2, LCK and FYN (By similarity). Expressed on Treg cells can inhibit Th17 cell responses (PubMed:24838857). Receptor for LGALS9 (PubMed:16286920, PubMed:24337741). Binding to LGALS9 is believed to result in suppression of T-cell responses; the resulting apoptosis of antigen-specific cells may implicate HAVCR2 phosphorylation and disruption of its association with BAG6. Binding to LGALS9 is proposed to be involved in innate immune response to intracellular pathogens. Expressed on Th1 cells interacts with LGALS9 expressed on Mycobacterium tuberculosis-infected macrophages to stimulate antibactericidal activity including IL-1 beta secretion and to restrict intracellular bacterial growth (By similarity). However, the function as receptor for LGALS9 has been challenged (PubMed:23555261). Also reported to enhance CD8+ T-cell responses to an acute infection such as by Listeria monocytogenes (By similarity). Receptor for phosphatidylserine (PtSer); PtSer-binding is calcium-dependent. May recognize PtSer on apoptotic cells leading to their phagocytosis. Mediates the engulfment of apoptotic cells by dendritic cells. Expressed on T-cells, promotes conjugation but not engulfment of apoptotic cells. Expressed on dendritic cells (DCs) positively regulates innate immune response and in synergy with Toll-like receptors promotes secretion of TNF-alpha. In tumor-imfiltrating DCs suppresses nucleic acid-mediated innate immune repsonse by interaction with HMGB1 and interfering with nucleic acid-sensing and trafficking of nucleid acids to endosomes (By similarity). Expressed on natural killer (NK) cells acts as a coreceptor to enhance IFN-gamma production in response to LGALS9 (PubMed:22323453). In contrast, shown to suppress NK cell-mediated cytotoxicity (PubMed:22383801). Negatively regulates NK cell function in LPS-induced endotoxic shock.
  • Tissue specificity

    Expressed in T-helper type 1 (Th1) lymphocytes. Expressed on regulatory T (Treg) cells after TCR stimulation. Expressed in dendritic cells and natural killer (NK) cells. Expressed in epithelial tissues. Expression is increased on CD4+ and CD8+ T-cells in chronic hepatitis C virus (HCV) infection. In progressive HIV-1 infection, expression is up-regulated on HIV-1-specific CD8 T-cells.
  • Involvement in disease

    May be involved in T-cell exhaustion associated with chronic viral infections such as with human immunodeficiency virus (HIV) and hepatitic C virus (HCV).
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. TIM family.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    O-glycosylated with core 1 or possibly core 8 glycans.
    Phosphorylated on tyrosine residues; modestly increased after TCR/CD28 stimulation. Can be phosphorylated in the cytoplasmatic domain by FYN (By similarity). Phosphorylation at Tyr-265 is increased by stimulation with ligand LGALS9.
  • Cellular localization

    Membrane. Cell junction. Localizes to the immunological synapse between CD8+ T-cells and target cells.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD366 antibody
    • FLJ14428 antibody
    • HAVcr-2 antibody
    • Havcr2 antibody
    • HAVR2_HUMAN antibody
    • Hepatitis A virus cellular receptor 2 antibody
    • Kidney injury molecule 3 antibody
    • KIM 3 antibody
    • KIM3 antibody
    • T cell immunoglobulin and mucin domain containing 3 antibody
    • T cell immunoglobulin mucin 3 antibody
    • T-cell immunoglobulin and mucin domain-containing protein 3 antibody
    • T-cell immunoglobulin mucin family member 3 antibody
    • T-cell immunoglobulin mucin receptor 3 antibody
    • T-cell membrane protein 3 antibody
    • Tim 3 antibody
    • TIM-3 antibody
    • TIM3 antibody
    • TIMD-3 antibody
    • TIMD3 antibody
    see all

Images

  • All lanes : Anti-TIM 3 antibody (ab185703) at 1/1000 dilution

    Lane 1 : HepG2 cell lysate
    Lane 2 : BxPC-3 cell lysate
    Lane 3 : BT-474 cell lysate
    Lane 4 : U-937 cell lysate
    Lane 5 : Mouse lung tissue lysate
    Lane 6 : Mouse thymus tissue lysate

    Lysates/proteins at 25 µg per lane.

    Secondary
    All lanes : HRP Goat Anti-Rabbit IgG

    Developed using the ECL technique.

    Predicted band size: 33 kDa


    Exposure time: 10 seconds
  • Immunohistochemical analysis of paraffin-embedded human lung cancer tissue staining TIM 3 with ab185703 at 1/200 dilution.

  • All lanes : Anti-TIM 3 antibody (ab185703) at 1/1000 dilution

    Lane 1 : HepG2 cell lysate
    Lane 2 : A-549 cell lysate
    Lane 3 : THP-1 cell lysate
    Lane 4 : Mouse spleen tissue lysate
    Lane 5 : Mouse lung tissue lysate
    Lane 6 : Mouse thymus tissue lysate
    Lane 7 : Rat spleen tissue lysate

    Lysates/proteins at 25 µg per lane.

    Secondary
    All lanes : HRP Goat Anti-Rabbit IgG

    Developed using the ECL technique.

    Predicted band size: 33 kDa


    Exposure time: 30 seconds
  • Immunohistochemical analysis of paraffin-embedded mouse spleen tissue staining TIM 3 with ab185703 at 1/200 dilution.

  • Immunohistochemical analysis of paraffin-embedded human tonsil tissue staining TIM 3 with ab185703 at 1/200 dilution.

References

This product has been referenced in:

  • Huang N  et al. Spleen-Associated Effects on Immunity in Hepatitis B Virus-Related Cirrhosis with Portal Hypertension. J Interferon Cytokine Res 39:95-105 (2019). Read more (PubMed: 30676849) »
  • Qin A  et al. Critical role of Tim-3 mediated autophagy in chronic stress induced immunosuppression. Cell Biosci 9:13 (2019). Read more (PubMed: 30680089) »
See all 14 Publications for this product

Customer reviews and Q&As

1-4 of 4 Abreviews or Q&A

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (mouse tumor tissue)
Permeabilization
Yes - PBST(0.5% v/v triton X-100, sigma)
Specification
mouse tumor tissue
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Apr 04 2019

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (mouse tumor tissue)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: citrate buffer
Permeabilization
Yes - 0.3% triton X-100
Specification
mouse tumor tissue
Blocking step
Serum as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Apr 04 2019

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Tonsil)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Ventana CC1 (EDTA pH8.5)
Permeabilization
No
Specification
Tonsil
Blocking step
Ventana blocking agent as blocking agent for 4 minute(s) · Concentration: 100% · Temperature: 36°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Jun 26 2017

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Blocking step
Dako Flex peroxidase as blocking agent for 5 minute(s) · Concentration: 100% · Temperature: RT°C
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: High pH
Sample
Human Tissue sections (Ovarian Tumour)
Specification
Ovarian Tumour
Permeabilization
No
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Jan 06 2015

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up