Anti-TIM 3 antibody (ab185703)
Rabbit polyclonal TIM 3 antibody. Validated in WB, IHC and tested in Mouse, Rat, Human. Cited in 9 publication(s). Independently reviewed in 2 review(s).
- Datasheet
- References (14)
- Protocols
Overview
-
Product name
Anti-TIM 3 antibody
See all TIM 3 primary antibodies -
Description
Rabbit polyclonal to TIM 3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human TIM 3 aa 22-202. Extracellular domain.
Sequence:SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTD ERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDE KFNLKLVIKPAKVTPAPTRQRDFTAAFPRMLTTRGHGPAETQTLGSLPDI NLTQISTLANELRDSRLANDLRDSGATIRIG
Database link: Q8TDQ0 -
Positive control
- WB: HepG2, BxPC-3, BT-474, U937, A-549, THP-1 cell lysates. Mouse spleen, lung and thymus. Rat spleen. IHC-P: Human lung cancer tissue, human tonsil tissue and mouse spleen tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.3
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab185703 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/2000. Predicted molecular weight: 33 kDa. | |
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol. |
Target
-
Function
Cell surface receptor implicated in modulating innate and adaptive immune responses. Generally accepted to have an inhibiting function. Reports on stimulating functions suggest that the activity may be influenced by the cellular context and/or the respective ligand (PubMed:24825777). Regulates macrophage activation (PubMed:11823861). Inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and promotes immunological tolerance (PubMed:14556005). In CD8+ cells attenuates TCR-induced signaling, specifically by blocking NF-kappaB and NFAT promoter activities resulting in the loss of IL-2 secretion. The function may implicate its association with LCK proposed to impair phosphorylation of TCR subunits, and/or LGALS9-dependent recruitment of PTPRC to the immunological synapse (PubMed:24337741, PubMed:26492563). In contrast, shown to activate TCR-induced signaling in T-cells probably implicating ZAP70, LCP2, LCK and FYN (By similarity). Expressed on Treg cells can inhibit Th17 cell responses (PubMed:24838857). Receptor for LGALS9 (PubMed:16286920, PubMed:24337741). Binding to LGALS9 is believed to result in suppression of T-cell responses; the resulting apoptosis of antigen-specific cells may implicate HAVCR2 phosphorylation and disruption of its association with BAG6. Binding to LGALS9 is proposed to be involved in innate immune response to intracellular pathogens. Expressed on Th1 cells interacts with LGALS9 expressed on Mycobacterium tuberculosis-infected macrophages to stimulate antibactericidal activity including IL-1 beta secretion and to restrict intracellular bacterial growth (By similarity). However, the function as receptor for LGALS9 has been challenged (PubMed:23555261). Also reported to enhance CD8+ T-cell responses to an acute infection such as by Listeria monocytogenes (By similarity). Receptor for phosphatidylserine (PtSer); PtSer-binding is calcium-dependent. May recognize PtSer on apoptotic cells leading to their phagocytosis. Mediates the engulfment of apoptotic cells by dendritic cells. Expressed on T-cells, promotes conjugation but not engulfment of apoptotic cells. Expressed on dendritic cells (DCs) positively regulates innate immune response and in synergy with Toll-like receptors promotes secretion of TNF-alpha. In tumor-imfiltrating DCs suppresses nucleic acid-mediated innate immune repsonse by interaction with HMGB1 and interfering with nucleic acid-sensing and trafficking of nucleid acids to endosomes (By similarity). Expressed on natural killer (NK) cells acts as a coreceptor to enhance IFN-gamma production in response to LGALS9 (PubMed:22323453). In contrast, shown to suppress NK cell-mediated cytotoxicity (PubMed:22383801). Negatively regulates NK cell function in LPS-induced endotoxic shock. -
Tissue specificity
Expressed in T-helper type 1 (Th1) lymphocytes. Expressed on regulatory T (Treg) cells after TCR stimulation. Expressed in dendritic cells and natural killer (NK) cells. Expressed in epithelial tissues. Expression is increased on CD4+ and CD8+ T-cells in chronic hepatitis C virus (HCV) infection. In progressive HIV-1 infection, expression is up-regulated on HIV-1-specific CD8 T-cells. -
Involvement in disease
May be involved in T-cell exhaustion associated with chronic viral infections such as with human immunodeficiency virus (HIV) and hepatitic C virus (HCV). -
Sequence similarities
Belongs to the immunoglobulin superfamily. TIM family.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Post-translational
modificationsO-glycosylated with core 1 or possibly core 8 glycans.
Phosphorylated on tyrosine residues; modestly increased after TCR/CD28 stimulation. Can be phosphorylated in the cytoplasmatic domain by FYN (By similarity). Phosphorylation at Tyr-265 is increased by stimulation with ligand LGALS9. -
Cellular localization
Membrane. Cell junction. Localizes to the immunological synapse between CD8+ T-cells and target cells. - Information by UniProt
-
Database links
- Entrez Gene: 84868 Human
- Entrez Gene: 171285 Mouse
- Entrez Gene: 363578 Rat
- Omim: 606652 Human
- SwissProt: Q8TDQ0 Human
- SwissProt: Q8VIM0 Mouse
- SwissProt: P0C0K5 Rat
- Unigene: 710500 Human
see all -
Alternative names
- CD366 antibody
- FLJ14428 antibody
- HAVcr-2 antibody
see all
Images
-
All lanes : Anti-TIM 3 antibody (ab185703) at 1/1000 dilution
Lane 1 : HepG2 cell lysate
Lane 2 : BxPC-3 cell lysate
Lane 3 : BT-474 cell lysate
Lane 4 : U-937 cell lysate
Lane 5 : Mouse lung tissue lysate
Lane 6 : Mouse thymus tissue lysate
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : HRP Goat Anti-Rabbit IgG
Developed using the ECL technique.
Predicted band size: 33 kDa
Exposure time: 10 seconds -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TIM 3 antibody (ab185703)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue staining TIM 3 with ab185703 at 1/200 dilution.
-
All lanes : Anti-TIM 3 antibody (ab185703) at 1/1000 dilution
Lane 1 : HepG2 cell lysate
Lane 2 : A-549 cell lysate
Lane 3 : THP-1 cell lysate
Lane 4 : Mouse spleen tissue lysate
Lane 5 : Mouse lung tissue lysate
Lane 6 : Mouse thymus tissue lysate
Lane 7 : Rat spleen tissue lysate
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : HRP Goat Anti-Rabbit IgG
Developed using the ECL technique.
Predicted band size: 33 kDa
Exposure time: 30 seconds -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TIM 3 antibody (ab185703)
Immunohistochemical analysis of paraffin-embedded mouse spleen tissue staining TIM 3 with ab185703 at 1/200 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TIM 3 antibody (ab185703)
Immunohistochemical analysis of paraffin-embedded human tonsil tissue staining TIM 3 with ab185703 at 1/200 dilution.
References
This product has been referenced in:
- Huang N et al. Spleen-Associated Effects on Immunity in Hepatitis B Virus-Related Cirrhosis with Portal Hypertension. J Interferon Cytokine Res 39:95-105 (2019). Read more (PubMed: 30676849) »
- Qin A et al. Critical role of Tim-3 mediated autophagy in chronic stress induced immunosuppression. Cell Biosci 9:13 (2019). Read more (PubMed: 30680089) »