Anti-TIM44 antibody (ab168649)
Key features and details
- Mouse polyclonal to TIM44
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TIM44 antibody
See all TIM44 primary antibodies -
Description
Mouse polyclonal to TIM44 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Full length protein corresponding to Human TIM44 aa 1-452.
Sequence:MAAAALRSGWCRCPRRCLGSGIQFLSSHNLPHGSTYQMRRPGGELPLSKS YSSGNRKGFLSGLLDNVKQELAKNKEMKESIKKFRDEARRLEESDVLQEA RRKYKTIESETVRTSEVLRKKLGELTGTVKESLHEVSKSDLGRKIKEGVE EAAKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGP YRRPQRLRKRTEFAGDKFKEEKVFEPNEEALGVVLHKDSKWYQQWKDFKE NNVVFNRFFEMKMKYDESDNAFIRASRALTDKVTDLLGGLFSKTEMSEVL TEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATYSQ LAHPIQQAKALGLQFHSRILDIDNVDLAMGKMMEQGPVLIITFQAQLVMV VRNPKGEVVEGDPDKVLRMLYVWALCRDQDELNPYAAWRLLDISASSTEQ IL
Database link: NP_006342.2 -
Positive control
- TIM44 transfected 293T cell lysate.
-
General notes
Previously labelled as TIMM44.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
pH: 7.4
Constituent: 99% PBS -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab168649 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 51 kDa. |
Target
-
Relevance
TIM44 is the essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. It recruits mitochondrial HSP70 to drive protein translocation into the matrix using ATP as an energy source. -
Cellular localization
Mitochondrion inner membrane. -
Database links
- Entrez Gene: 10469 Human
- Entrez Gene: 21856 Mouse
- Entrez Gene: 29635 Rat
- Omim: 605058 Human
- SwissProt: O43615 Human
- SwissProt: O35857 Mouse
- SwissProt: O35094 Rat
-
Alternative names
- DKFZp686H05241 antibody
- MIMT44 antibody
- Mitochondrial inner membrane translocase antibody
see all
Images
-
Western blot - Anti-TIM44 antibody (ab168649)All lanes : Anti-TIM44 antibody (ab168649) at 1 µg/ml
Lane 1 : TIMM44 transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Secondary
All lanes : Goat Anti-Mouse IgG (H&L)-HRP
at 1/2500 dilution
Developed using the ECL technique.
Predicted band size: 51 kDa
Datasheets and documents
References (1)
ab168649 has been referenced in 1 publication.
- Vais H et al. EMRE Is a Matrix Ca(2+) Sensor that Governs Gatekeeping of the Mitochondrial Ca(2+) Uniporter. Cell Rep 14:403-410 (2016). PubMed: 26774479
