Overview

  • Product name

  • Description

    Rabbit polyclonal to TIM44
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human TIM44 aa 116-218.
    Sequence:

    EVLRKKLGELTGTVKESLHEVSKSDLGRKIKEGVEEAAKTAKQSAESVSK GGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAG DKF


    Database link: O43615

  • Positive control

    • IHC-P: Human cerebral cortex, heart, gastrointestinal and testis tissue. WB: PC-3 and NBT-II cell lysate ICC/IF: A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab244466 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.4 µg/ml.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    TIM44 is the essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. It recruits mitochondrial HSP70 to drive protein translocation into the matrix using ATP as an energy source.
  • Cellular localization

    Mitochondrion inner membrane.
  • Database links

  • Alternative names

    • DKFZp686H05241 antibody
    • MIMT44 antibody
    • Mitochondrial inner membrane translocase antibody
    • TIM44 antibody
    • Translocase of inner mitochondrial membrane 44 antibody
    • Translocase of inner mitochondrial membrane 44 homolog (yeast) antibody
    see all

Images

  • All lanes : Anti-TIM44 antibody (ab244466) at 0.4 µg/ml

    Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate
    Lane 2 : NBT-II whole cell lysate
  • All lanes : Anti-TIM44 antibody (ab244466) at 0.4 µg/ml

    Lane 1 : PC-3 (human prostate adenocarcinoma cell line) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
  • All lanes : Anti-TIM44 antibody (ab244466) at 0.4 µg/ml

    Lane 1 : U-2 OS (human bone osteosarcoma epithelial cell line) cells transfected with siRNA probe#1
    Lane 2 : U-2 OS cells transfected with siRNA probe#2
    Lane 3 : U-2 OS cells transfected with siRNA control
  • All lanes : Anti-TIM44 antibody (ab244466) at 0.4 µg/ml

    Lane 1 : Caco-2 (Human colorectal adenocarcinoma cell line) cells transfected with a siRNA control
    Lane 2 : Caco-2 cells transfected with a siRNA control
    Lane 3 : Caco-2 cells transfected with a siRNA probe#2
  • Paraffin-embedded human testis tissue stained for TIM44 using ab244466 at 1/200 dilution in immunohistochemical analysis.
  • Paraffin-embedded human gastrointestinal tissue stained for TIM44 using ab244466 at 1/200 dilution in immunohistochemical analysis.
  • Paraffin-embedded human heart muscle tissue stained for TIM44 using ab244466 at 1/200 dilution in immunohistochemical analysis.
  • Paraffin-embedded human cerebral cortex tissue stained for TIM44 using ab244466 at 1/200 dilution in immunohistochemical analysis.
  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for TIM44 (green) using ab244466 at 4 μg/ml in ICC/IF.

References

ab244466 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244466.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up