Anti-TIM44 antibody (ab244466)
Key features and details
- Rabbit polyclonal to TIM44
- Suitable for: WB, ICC/IF, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-TIM44 antibody
See all TIM44 primary antibodies -
Description
Rabbit polyclonal to TIM44 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human TIM44 aa 116-218.
Sequence:EVLRKKLGELTGTVKESLHEVSKSDLGRKIKEGVEEAAKTAKQSAESVSK GGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAG DKF
Database link: O43615 -
Positive control
- IHC-P: Human cerebral cortex, heart, gastrointestinal and testis tissue. WB: PC-3 and NBT-II cell lysate ICC/IF: A431 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab244466 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.04 - 0.4 µg/ml. | |
| ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Relevance
TIM44 is the essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. It recruits mitochondrial HSP70 to drive protein translocation into the matrix using ATP as an energy source. -
Cellular localization
Mitochondrion inner membrane. -
Database links
- Entrez Gene: 10469 Human
- Entrez Gene: 21856 Mouse
- Entrez Gene: 29635 Rat
- Omim: 605058 Human
- SwissProt: O43615 Human
- SwissProt: O35857 Mouse
- SwissProt: O35094 Rat
-
Alternative names
- DKFZp686H05241 antibody
- MIMT44 antibody
- Mitochondrial inner membrane translocase antibody
see all
Images
-
Western blot - Anti-TIM44 antibody (ab244466)All lanes : Anti-TIM44 antibody (ab244466) at 0.4 µg/ml
Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate
Lane 2 : NBT-II whole cell lysate -
Immunocytochemistry/ Immunofluorescence - Anti-TIM44 antibody (ab244466)PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for TIM44 (green) using ab244466 at 4 μg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TIM44 antibody (ab244466)Paraffin-embedded human heart muscle tissue stained for TIM44 using ab244466 at 1/200 dilution in immunohistochemical analysis. -
Western blot - Anti-TIM44 antibody (ab244466)All lanes : Anti-TIM44 antibody (ab244466) at 0.4 µg/ml
Lane 1 : PC-3 (human prostate adenocarcinoma cell line) whole cell lysate
Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate -
Western blot - Anti-TIM44 antibody (ab244466)All lanes : Anti-TIM44 antibody (ab244466) at 0.4 µg/ml
Lane 1 : U-2 OS (human bone osteosarcoma epithelial cell line) cells transfected with siRNA probe#1
Lane 2 : U-2 OS cells transfected with siRNA probe#2
Lane 3 : U-2 OS cells transfected with siRNA control -
Western blot - Anti-TIM44 antibody (ab244466)All lanes : Anti-TIM44 antibody (ab244466) at 0.4 µg/ml
Lane 1 : Caco-2 (Human colorectal adenocarcinoma cell line) cells transfected with a siRNA control
Lane 2 : Caco-2 cells transfected with a siRNA control
Lane 3 : Caco-2 cells transfected with a siRNA probe#2 -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TIM44 antibody (ab244466)Paraffin-embedded human cerebral cortex tissue stained for TIM44 using ab244466 at 1/200 dilution in immunohistochemical analysis. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TIM44 antibody (ab244466)Paraffin-embedded human testis tissue stained for TIM44 using ab244466 at 1/200 dilution in immunohistochemical analysis. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TIM44 antibody (ab244466)Paraffin-embedded human gastrointestinal tissue stained for TIM44 using ab244466 at 1/200 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab244466 has not yet been referenced specifically in any publications.
