Anti-TIM44 antibody (ab244466)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-TIM44 antibody
See all TIM44 primary antibodies -
Description
Rabbit polyclonal to TIM44 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human -
Immunogen
Recombinant fragment corresponding to Human TIM44 aa 116-218.
Sequence:EVLRKKLGELTGTVKESLHEVSKSDLGRKIKEGVEEAAKTAKQSAESVSK GGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAG DKF
Database link: O43615 -
Positive control
- IHC-P: Human cerebral cortex, heart, gastrointestinal and testis tissue. WB: PC-3 and NBT-II cell lysate ICC/IF: A431 cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab244466 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.4 µg/ml. | |
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
| IHC-P | 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Relevance
TIM44 is the essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. It recruits mitochondrial HSP70 to drive protein translocation into the matrix using ATP as an energy source. -
Cellular localization
Mitochondrion inner membrane. -
Database links
- Entrez Gene: 10469 Human
- Entrez Gene: 21856 Mouse
- Entrez Gene: 29635 Rat
- Omim: 605058 Human
- SwissProt: O43615 Human
- SwissProt: O35857 Mouse
- SwissProt: O35094 Rat
-
Alternative names
- DKFZp686H05241 antibody
- MIMT44 antibody
- Mitochondrial inner membrane translocase antibody
see all
Images
-
Western blot - Anti-TIM44 antibody (ab244466)All lanes : Anti-TIM44 antibody (ab244466) at 0.4 µg/ml
Lane 1 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate
Lane 2 : NBT-II whole cell lysate -
Western blot - Anti-TIM44 antibody (ab244466)All lanes : Anti-TIM44 antibody (ab244466) at 0.4 µg/ml
Lane 1 : PC-3 (human prostate adenocarcinoma cell line) whole cell lysate
Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate -
Western blot - Anti-TIM44 antibody (ab244466)All lanes : Anti-TIM44 antibody (ab244466) at 0.4 µg/ml
Lane 1 : U-2 OS (human bone osteosarcoma epithelial cell line) cells transfected with siRNA probe#1
Lane 2 : U-2 OS cells transfected with siRNA probe#2
Lane 3 : U-2 OS cells transfected with siRNA control -
Western blot - Anti-TIM44 antibody (ab244466)All lanes : Anti-TIM44 antibody (ab244466) at 0.4 µg/ml
Lane 1 : Caco-2 (Human colorectal adenocarcinoma cell line) cells transfected with a siRNA control
Lane 2 : Caco-2 cells transfected with a siRNA control
Lane 3 : Caco-2 cells transfected with a siRNA probe#2 -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TIM44 antibody (ab244466)Paraffin-embedded human testis tissue stained for TIM44 using ab244466 at 1/200 dilution in immunohistochemical analysis. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TIM44 antibody (ab244466)Paraffin-embedded human gastrointestinal tissue stained for TIM44 using ab244466 at 1/200 dilution in immunohistochemical analysis. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TIM44 antibody (ab244466)Paraffin-embedded human heart muscle tissue stained for TIM44 using ab244466 at 1/200 dilution in immunohistochemical analysis. -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TIM44 antibody (ab244466)Paraffin-embedded human cerebral cortex tissue stained for TIM44 using ab244466 at 1/200 dilution in immunohistochemical analysis. -
Immunocytochemistry/ Immunofluorescence - Anti-TIM44 antibody (ab244466)PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for TIM44 (green) using ab244466 at 4 μg/ml in ICC/IF.
Datasheets and documents
References
ab244466 has not yet been referenced specifically in any publications.
