Overview

  • Product name

  • Description

    Rabbit polyclonal to TIM50
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human TIM50 aa 167-249.
    Sequence:

    TGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISY RLFRDATRYMDGHHVKDISCLNRDPARVVVVDC


    Database link: Q3ZCQ8

  • Positive control

    • Human kidney tissue. A549 cells. RT-4 and U-251 MG cell lysate.
  • General notes

    Previously labelled as TIMM50. 

Properties

Applications

Our Abpromise guarantee covers the use of ab204486 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 40 kDa.

Target

  • Function

    Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. Has some phosphatase activity in vitro; however such activity may not be relevant in vivo. Isoform 2 may participate in the release of snRNPs and SMN from the Cajal body.
  • Tissue specificity

    Widely expressed. Expressed at higher level in brain, kidney and liver (at protein level).
  • Sequence similarities

    Belongs to the TIM50 family.
    Contains 1 FCP1 homology domain.
  • Domain

    The FCP1 homology domain does not contain the canonical D-x-D-x-[TV] active site, suggesting that it probably does not display phosphatase activity in vivo.
  • Cellular localization

    Mitochondrion inner membrane and Nucleus speckle. Nuclear and enriched in speckles with snRNPs.
  • Information by UniProt
  • Database links

  • Alternative names

    • Homolog of yeast Tim50 antibody
    • Import inner membrane translocase subunit TIM 50 antibody
    • Import inner membrane translocase subunit TIM50 antibody
    • Import inner membrane translocase subunit TIM50 mitochondrial antibody
    • MGC102733 antibody
    • Mitochondrial import inner membrane translocase subunit TIM50 antibody
    • TIM 50 antibody
    • TIM 50L antibody
    • TIM50 antibody
    • Tim50 like protein antibody
    • TIM50_HUMAN antibody
    • TIM50L antibody
    • TIMM 50 antibody
    • TIMM50 antibody
    • translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae) antibody
    • Translocase of inner mitochondrial membrane 50 homolog (yeast) antibody
    • Translocase of inner mitochondrial membrane 50 homolog antibody
    • Translocase of inner mitochondrial membrane 50, yeast, homolog of antibody
    see all

Images

  • All lanes : Anti-TIM50 antibody (ab204486) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate

    Developed using the ECL technique.

    Predicted band size: 40 kDa

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling TIM50 using ab204486 at a 1/50 dilution.

  • Immunofluorescent analysis of paraformaldehyde-fixed A549 cells labeling TIM50 using ab204486 at 4 µg/ml.

References

ab204486 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204486.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up