Overview

  • Product name

    Anti-TIMM23/TIM23 antibody
    See all TIMM23/TIM23 primary antibodies
  • Description

    Rabbit polyclonal to TIMM23/TIM23
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human TIMM23/TIM23 aa 1-209.
    Sequence:

    MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDP RYLVQDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGL KETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRG AEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHM KGSLLQQSL


    Database link: O14925

  • Positive control

    • WB: Mouse heart and liver tissue lysates; A431, MCF7 and Jurkat whole cell lysate (ab7899). IHC-P: Human testis tissue and ovarian cancer tissue.
  • General notes

     This product was previously labelled as TIMM23

     

Properties

Applications

Our Abpromise guarantee covers the use of ab230253 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 22 kDa (predicted molecular weight: 22 kDa).

Target

  • Relevance

    TIMM23 belongs to the Tim17/Tim22/Tim23 family and is an essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
  • Cellular localization

    Mitochondrion inner membrane; Multi-pass membrane protein.
  • Database links

  • Alternative names

    • MGC22767 antibody
    • MGC93478 antibody
    • Mitochondrial import inner membrane translocase subunit Tim23 antibody
    • Predicted protein of HQ1197 antibody
    • PRO1197 antibody
    • TIM23 antibody
    • TIMM 23 antibody
    • TIMM23 antibody
    • Translocase of inner mitochondrial membrane 23 (yeast) homolog antibody
    • Translocase of inner mitochondrial membrane 23 homolog (yeast) antibody
    • Translocase of inner mitochondrial membrane 23 homolog B antibody
    • Translocation of mitochondrial precursor proteins antibody
    see all

Images

  • All lanes : Anti-TIMM23/TIM23 antibody (ab230253) at 1/1000 dilution

    Lane 1 : Mouse heart tissue lysate
    Lane 2 : Mouse liver tissue lysate
    Lane 3 : A431 (human epidermoid carcinoma cell line) whole cell lysate
    Lane 4 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 5 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 22 kDa
    Observed band size: 22 kDa

  • Paraffin-embedded human testis tissue stained for TIMM23/TIM23 with ab230253 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human ovarian cancer tissue stained for TIMM23/TIM23 with ab230253 at 1/100 dilution in immunohistochemical analysis.

References

ab230253 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Nothobranchius furzeri Tissue lysate - whole (Liver)
Gel Running Conditions
Non-reduced Denaturing (12% gel)
Loading amount
40 µg
Specification
Liver
Blocking step
BSA as blocking agent for 45 minute(s) · Concentration: 5% · Temperature: RT°C

Abcam user community

Verified customer

Submitted Apr 03 2019

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up