Overview

  • Product name

    Anti-TIMM9 antibody
  • Description

    Rabbit polyclonal to TIMM9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Xenopus laevis
  • Immunogen

    Recombinant full length protein corresponding to Human TIMM9 aa 2-89.
    Sequence:

    AAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEH CLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR


    Database link: Q9Y5J7

  • Positive control

    • IHC-P: Human stomach tissue. ICC/IF: U-251 MG cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224320 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.
  • Tissue specificity

    Ubiquitous, with highest expression in heart, kidney, liver and skeletal muscle.
  • Sequence similarities

    Belongs to the small Tim family.
  • Domain

    The twin CX3C motif contains 4 conserved Cys residues that form 2 disulfide bonds in the mitochondrial intermembrane space. However, during the transit of TIMM9 from cytoplasm into mitochondrion, the Cys residues probably coordinate zinc, thereby preventing folding and allowing its transfer across mitochondrial outer membrane.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Mitochondrial import inner membrane translocase subunit Tim9 antibody
    • TIM9 antibody
    • TIM9_HUMAN antibody
    • TIM9A antibody
    • Timm9 antibody
    • TIMM9A antibody
    see all

Images

  • PFA-fixed/Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for TIMM9 (green) using ab224320 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human stomach tissue stained for TIMM9 using ab224320 at 1/50 dilution in immunohistochemical analysis.

References

ab224320 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224320.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up