Anti-TIMP1 antibody [167191] (ab234662)
Key features and details
- Mouse monoclonal [167191] to TIMP1
- Suitable for: IHC-P
- Reacts with: Rat
- Isotype: IgG1
Overview
-
Product name
Anti-TIMP1 antibody [167191]
See all TIMP1 primary antibodies -
Description
Mouse monoclonal [167191] to TIMP1 -
Host species
Mouse -
Specificity
This antibody is specific for rat TIMP1 denatured and native forms. -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Rat -
Immunogen
Recombinant full length protein corresponding to Rat TIMP1 aa 24-217. 1-23aa refer to the signal peptide of this protein.
Sequence:CSCAPTHPQTAFCNSDLVIRAKFMGSPEIIETTLYQRYEIKMTKMLKGFD AVGNATGFRFAYTPAMESLCGYVHKSQNRSEEFLIAGRLRNGNLHITACS FLVPWHNLSPAQQKAFVKTYSAGCGVCTVFPCSAIPCKLESDSHCLWTDQ ILMGSEKGYQSDHFACLPRNPDLCTWQYLGVSMTRSLPLAKAEA
Database link: P30120 -
Positive control
- IHC-P: Rat prostate cancer tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: 50% Glycerol, PBS, 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95% -
Clonality
Monoclonal -
Clone number
167191 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab234662 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/50 - 1/500. |
Target
-
Function
Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Also mediates erythropoiesis in vitro; but, unlike IL-3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-11, MMP-12, MMP-13 and MMP-16. Does not act on MMP-14. -
Sequence similarities
Belongs to the protease inhibitor I35 (TIMP) family.
Contains 1 NTR domain. -
Post-translational
modificationsThe activity of TIMP1 is dependent on the presence of disulfide bonds. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 116510 Rat
- SwissProt: P30120 Rat
- Unigene: 25754 Rat
-
Alternative names
- Clgi antibody
- Collagenase inhibitor antibody
- Collagenase inhibitor, Human antibody
see all
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab234662 has not yet been referenced specifically in any publications.