Overview

  • Product name

  • Description

    Rabbit polyclonal to TIMP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit, Guinea pig, Cow, Dog, Chinese hamster
  • Immunogen

    Recombinant full length protein corresponding to Human TIMP2 aa 27-220. Mature protein.
    Sequence:

    CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQI KMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITL CDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMD WVTEKNINGHQAKFFACIKRSDGSCAWYRG AAPPKQEFLDIEDP


    Database link: P16035

  • Positive control

    • SW480 cell line extract.

Properties

Applications

Our Abpromise guarantee covers the use of ab180630 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 24 kDa.
ICC/IF Use at an assay dependent concentration.

Target

Images

  • Anti-TIMP2 antibody (ab180630) at 1/500 dilution + SW480 cell line extract

    Predicted band size: 24 kDa

References

This product has been referenced in:

  • Yin S  et al. MicroRNA-130a regulated by HPV18 E6 promotes proliferation and invasion of cervical cancer cells by targeting TIMP2. Exp Ther Med 17:2837-2846 (2019). Read more (PubMed: 30906471) »
  • Zhang Y  et al. Inhibition of miR-214 attenuates the migration and invasion of triple-negative breast cancer cells. Mol Med Rep 19:4035-4042 (2019). Read more (PubMed: 30942417) »
See all 19 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180630.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up