Overview

  • Product name
  • Description
    Rabbit polyclonal to TIMP2
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Rat, Cow
    Predicted to work with: Mouse, Rabbit, Horse, Guinea pig, Dog, Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Horse TIMP2 aa 2-88. (Expressed in E.coli).
    Sequence:

    AVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDKDIEFIYTAPSSAVC GVSLDVGGKKEYLIAGKADGNGKMHITLCDFIVPWDT


    Database link: O77717

  • Positive control
    • WB: Rat placenta lysate; Cow cerebrum and kidney lysates; Recombinant horse TIMP2 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231176 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 24 kDa.

Target

Images

  • Anti-TIMP2 antibody (ab231176) at 2 µg/ml + Recombinant horse TIMP2 protein

    Predicted band size: 24 kDa

  • Anti-TIMP2 antibody (ab231176) at 2 µg/ml + Rat placenta lysate

    Predicted band size: 24 kDa

  • Anti-TIMP2 antibody (ab231176) at 2 µg/ml + Cow cerebrum lysate

    Predicted band size: 24 kDa

  • Anti-TIMP2 antibody (ab231176) at 2 µg/ml + Cow kidney lysate

    Predicted band size: 24 kDa

References

ab231176 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231176.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up