Overview

  • Product name

    Anti-TIMP3 antibody - BSA and Azide free
    See all TIMP3 primary antibodies
  • Description

    Rabbit polyclonal to TIMP3 - BSA and Azide free
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Cow, Dog, Cynomolgus monkey, Rhesus monkey
  • Immunogen

    Recombinant fragment corresponding to Human TIMP3 aa 175-211 (C terminal).
    Sequence:

    PGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP


    Database link: P35625

  • Positive control

    • IHC-P: Human placenta tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab213063 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 1 - 2 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

(Primary incubation for 30 minutes at RT).

Target

  • Function

    Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15.
  • Involvement in disease

    Defects in TIMP3 are the cause of Sorsby fundus dystrophy (SFD) [MIM:136900]. SFD is a rare autosomal dominant macular disorder with an age of onset in the fourth decade. It is characterized by loss of central vision from subretinal neovascularization and atrophy of the ocular tissues. Generally, macular disciform degeneration develops in the patients eye within 6 months to 6 years.
  • Sequence similarities

    Belongs to the protease inhibitor I35 (TIMP) family.
    Contains 1 NTR domain.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • HSMRK222 antibody
    • K222 antibody
    • K222TA2 antibody
    • Metalloproteinase inhibitor 3 antibody
    • MIG 5 protein antibody
    • MIG5 protein antibody
    • Protein MIG 5 antibody
    • Protein MIG-5 antibody
    • SFD antibody
    • Sorsby fundus dystrophy pseudoinflammatory antibody
    • TIMP 3 antibody
    • TIMP metallopeptidase inhibitor 3 antibody
    • TIMP-3 antibody
    • TIMP3 antibody
    • TIMP3_HUMAN antibody
    • Tissue Inhibitor of Metalloproteinase 3 antibody
    • Tissue inhibitor of metalloproteinases 3 antibody
    • Tissue inhibitor of metalloproteinases3 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human placenta tissue stained for TIMP3 with ab213063 at 2 µg/ml in immunohistochemical analysis.

    This data was developed using the same anti-TIMP3 antibody in a different buffer formulation.

References

ab213063 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab213063.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up