Anti-TIP-1 antibody (ab220383)
Key features and details
- Rabbit polyclonal to TIP-1
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TIP-1 antibody
See all TIP-1 primary antibodies -
Description
Rabbit polyclonal to TIP-1 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Recombinant fragment corresponding to Human TIP-1 aa 65-124.
Sequence:PAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSL QKAVQQSMLS
Database link: O14907 -
Positive control
- RT-4 and U-251 MG cell lysates; U-2 OS cells.
-
General notes
Previously labelled as TAX1BP3.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab220383 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 14 kDa. | |
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. |
Target
-
Function
May play a role in the Rho signaling pathway. May act as an inhibitor of the Wnt signaling pathway. May play a role in activation of CDC42 by the viral protein HPV16 E6. -
Tissue specificity
Detected in various cell lines including HeLa. Weakly expressed in peripheral blood leukocytes. -
Sequence similarities
Contains 1 PDZ (DHR) domain. -
Cellular localization
Cytoplasm. Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 30851 Human
- Entrez Gene: 76281 Mouse
- SwissProt: O14907 Human
- SwissProt: Q9DBG9 Mouse
- Unigene: 12956 Human
- Unigene: 371656 Mouse
-
Alternative names
- Glutaminase interacting protein 3 antibody
- Glutaminase-interacting protein 3 antibody
- Tax interaction protein 1 antibody
see all
Images
-
Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling TIP-1 with ab220383 at 4 µg/ml (green).
-
All lanes : Anti-TIP-1 antibody (ab220383) at 1/100 dilution
Lane 1 : RT-4 cell lysate
Lane 2 : U-251 MG cell lysate
Predicted band size: 14 kDa
Protocols
Datasheets and documents
References (0)
ab220383 has not yet been referenced specifically in any publications.